KEGG   Nothobranchius furzeri (turquoise killifish): 107380509
Entry
107380509         CDS       T05163                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107380509 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nfu03000]
    107380509 (mecom)
Transcription factors [BR:nfu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    107380509 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED PyrI_C
Other DBs
NCBI-GeneID: 107380509
NCBI-ProteinID: XP_015807275
Position
sgr06
AA seq 1075 aa
MKAEDFSCDTMAPDIHEERQYRCEDCDQNFESRTQLLDHQKQPCGMPPSSFLNPGGDSDL
KAQEPQDLQPLHMSHGLHECKECDQVFPDVQSLEAHTLSHSEEREYKCDQCPKAFNWKSN
LIRHQMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATSSGLK
QHKHIHSSVKPFMCKSLRPYLCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFST
TSSLNKHRRFCEGKNHFTAGGLFAQGMPLPGTPGLDKTALAIGHSSAGLADYFGASRHHS
GLTFPAAPAFPFSFPGLFPSGLYHRPPLIPATTSPVRQPVQAPVAGPGADLSKSPLLPSS
PGALESQELLKALRKDGSSPGSQIPNSELLNQGLSSTTKQNKQSDHSESSDLDDVSTPSG
SDLESTTGSELESDMDSERERGAARENGKGPKRKSREGVSQSPGFSKSASKDFPGPSFIQ
SSLDEHTAVTGAVNDSIKAIASIAEKYFGSTGLAGLQEKKVGSLPYPSMFSLPFFPAFSP
PVYPFPERDLRPTDLKGEPQSPEDGKKAQTKSSSESPFDLTTKRKEEKLARFASSKLEAS
HPTGQDQPLDLSLGSRGRGRTPKQEEAKKNPSYDDEKKRVVEIPKADSSLQHARPTPFFM
DPIYSRVEKRRMSDPFEALKDKYMRPAPGFLFHPQFRLPDQRTWMTAIENMAEKLETFSS
LKPESSELLRSVPSMFDFRAPPSTLPETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHT
GEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGN
LSGTAMSSPQSELDSGSAILDDKEDSYFNEIRNFISNAGQNHTSPGHSEERLNGGPLEDG
KPLMASHGLQDLEDEEVEDLEADDEEAEEPSSEKRESNLHPSSLSDDIIQDEMDFSELSD
LNLSCKTSPRRYKDEEEEQNSYSALDRIHRFADLRKLEESELSDGDEDDGAFGSPSLEAV
KQPLFRKSKSQAYAMMLSLAEKDSLHSATHTPATMWHSLARAAAESSAIQSFSHV
NT seq 3228 nt   +upstreamnt  +downstreamnt
atgaaggctgaagatttttcatgtgacaccatggctcctgatattcacgaggaaaggcag
taccgatgtgaagactgtgaccagaactttgagtcccgcacccagctgctggaccaccag
aagcagccatgcgggatgcccccctcttcttttcttaacccagggggagatagtgacctg
aaagcccaagaacctcaagacctgcagccccttcacatgtctcacggcctgcatgagtgt
aaggagtgtgatcaggtcttccctgatgtccagagcctggaggctcacaccctgtcacac
tccgaggagagggaatacaagtgtgatcagtgtcccaaggccttcaactggaaatcaaac
ctaatccgacatcagatgtcacatgatagcggcaaacactatgaatgtgaaaactgctca
aagcaggtgttcacagaccccagtaacctacagaggcacattcgctcgcagcacgtcggg
gctcgtgctcacgcctgctccgactgcggcaagacgtttgcaacgtcatcgggcctcaag
cagcataagcacatccacagcagtgtcaagcccttcatgtgtaagtcactaagaccctac
ctatgtgaggtatgccacaagtcctacacccagttctctaacctttgccggcacaagcgc
atgcacgctgactgccgcacacagatcaagtgcaaggactgcgggcaaatgttcagcacc
acttcatccctcaacaagcatcggcgcttctgtgagggaaagaatcacttcacagcaggg
ggactgtttgcccagggcatgccactacctggcacccctggcttggacaaaacagccctt
gcaattggccacagcagtgctggactggctgattactttggggctagccgccaccatagt
ggcctaaccttccctgcagctccagcatttcctttcagctttcctggcttgtttccttct
ggactctatcatcgcccaccactcattcccgccaccacatctcctgtccgacagccagtt
caggcacctgttgcggggcctggtgcagacctgagtaaaagccccttgcttccttcaagc
ccaggtgctctggagtcgcaggagttgctgaaggccctccgaaaagatggcagttcacct
ggaagtcagataccaaactcagagctccttaatcagggtttatcttcaactacaaagcag
aacaagcagagtgaccattctgaaagcagcgacctggatgacgtcagcacaccaagtgga
agtgatctagagagcacgacgggctccgagcttgagagtgatatggacagtgaaagggag
aggggagctgctagagaaaacggcaaaggtcccaagagaaagtctcgcgagggagtctct
caaagcccgggctttagcaaaagtgctagcaaagactttccaggaccttcatttattcag
tcttcactggacgaacacacagctgtaacaggagctgtcaatgactctattaaggccatc
gcctctattgcggagaagtactttggctcaactgggcttgctggcttacaagaaaagaag
gtcggatctctgccctacccttcaatgttctcactgcctttcttcccagcattctctcca
ccagtttaccctttcccagaaagggatctcagaccaacagacctgaagggtgagccacaa
tcaccagaagatggcaaaaaggcacagaccaagtcatcatctgagtcaccgtttgacctg
acaacaaagagaaaagaggaaaagttagcccgctttgcttcctccaaactagaggcctct
caccctactggtcaagatcaaccactagatttgagtcttgggtctaggggtcgtggacgt
actccaaagcaggaggaggctaaaaagaacccaagctatgatgatgagaagaagagagtg
gtggaaattccaaaagctgattcctccttacagcacgccagacccaccccctttttcatg
gaccccatctacagcagggttgagaagaggagaatgagcgatccgtttgaggctctgaaa
gacaaatacatgcgaccagctccaggcttccttttccatccacagtttcgtttgccagat
cagagaacttggatgacagcgatcgagaacatggcagagaagttggagacgttcagctca
ttaaagccggagtccagtgaactgctgcgatccgttccctccatgtttgacttcagagcc
ccaccgtcgacgcttccagagacactgctgcgcaaaggcaaagagcgctacacatgcaga
tactgtggaaaaatcttccctcgttctgccaacctgactcgtcacctcagaactcatact
ggagaacaaccatacaggtgtaaatactgcgaccgctccttcagtatctcgtccaacctg
caacggcacattcgtaacatccacaacaaggagaagcccttcaagtgccacctgtgcgac
cgctgcttcggtcagcagaccaacctcgaccgtcaccttaaaaagcacgagaacggcaat
ctgtcaggaactgcgatgtcatcgccacagtctgagctggacagcggcagcgccatattg
gacgacaaagaggactcctactttaacgaaataagaaacttcatcagcaacgcaggacag
aaccacacctcaccgggtcattctgaggaacggctgaacggaggtccattagaagatggg
aaaccactgatggccagccacgggttgcaggacctggaagatgaagaagtggaagaccta
gaagcagacgatgaagaagcagaggagcctagttctgagaaaagagaaagcaatttgcat
cctagcagcctgagtgatgacatcatccaggacgaaatggacttcagtgagctgagcgac
ttaaatctcagctgtaaaacatctccaaggaggtataaggatgaagaggaggagcagaac
agctactcggccttggatcgtatccatcggtttgctgacctgcgcaagctggaggagagt
gagctgagtgatggagacgaagatgatggagcatttggttctccttcacttgaagctgtc
aaacagccactctttaggaaatccaagtctcaagcgtatgccatgatgctgtctctggct
gaaaaggactctcttcactcagccacacacactccagcgaccatgtggcacagtctggcc
cgggcagctgcagaatccagcgcaatccagtccttcagccatgtatga

DBGET integrated database retrieval system