KEGG   Nothobranchius furzeri (turquoise killifish): 107380623Help
Entry
107380623         CDS       T05163                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like isoform X1
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04020  Calcium signaling pathway
nfu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107380623
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107380623
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nfu04030]
    107380623
G protein-coupled receptors [BR:nfu04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    107380623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 107380623
NCBI-ProteinID: XP_015807411
UniProt: A0A1A7ZZW4
Position
sgr01
AA seq 408 aa AA seqDB search
MNVSATGQMPVMEELVSESDSIPRQMALICFLSLVMLMSVLGNLLVMVAVCKDRQLRKIK
TNYFIVSLAFADLLVSVLVMPFGTIELVYENWIYGETFCLVRTSLDVLLTTASILHLCCI
ALDRYYAICCKPLVYRNKMTPLRVALMIGGCWVIPTFISFLPIMQGWNTIGIHENIEKKR
NMSSSNSTSCVFMVNKPYALTCSLVAFYIPLVLMVLAYQRIYITARAHALQISMLQRAGG
AGASTPGTSGAGTGVGVGAASDSADHQRNHRMRTETKAAKTLCIIMGCFCLCWAPFFVTN
VVDPFIDYTVPEQLWTACLWLGYINSMLNPILYAFLNKSFRRAFLIILCCGRKRYSRPSI
MAPSTATTVTQINGSTHVLKYSVLHNGNHKEQEKKPLHMNIDFHESCL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcagcgctacaggccagatgccggtgatggaggagcttgtcagtgagagtgac
agcataccaaggcagatggctctgatctgcttcctgtctttggtcatgctgatgagcgtc
ctgggaaacctgctggtcatggtggccgtctgcaaggacagacaactaaggaaaatcaag
accaactatttcatcgtgtccctggcgtttgctgacctgctcgtgtcagtgctggtaatg
ccttttggtaccatcgagctggtctacgagaactggatctacggtgaaacgttctgtctg
gttcggacgtcgttagatgttctgctgaccactgcttctatacttcacctgtgctgcatc
gctctggacagatactacgctatctgctgcaagcctttggtctacaggaacaaaatgaca
ccattacgagttgctttaatgatcggtggctgctgggttattcccactttcatctccttc
ctacccatcatgcagggctggaacaccatcggcatccatgaaaatattgagaagaagcgc
aacatgtcaagcagtaactccacctcctgtgtcttcatggtcaacaagccatatgccctc
acctgctctttggtggctttctacatccccttggtcctcatggtgctggcttaccagagg
atctacatcacggctcgagcccacgcccttcagatcagcatgctgcagcgggcaggcggg
gctggggccagcactcctgggacttctggtgctggcacaggagtgggagttggtgcagct
tcagattctgccgaccatcaacgcaaccatcgcatgcgaacagaaactaaggcagcaaag
actctatgcatcattatgggatgtttctgcctctgttgggcaccgttctttgtcacaaac
gtggtggacccatttatagactacacagtgcccgagcagctgtggacagcctgcctgtgg
ctgggttacataaactccatgctgaaccccatcctctacgccttcctcaacaaatccttt
cgtcgtgcctttctcatcattttatgttgtgggaggaagaggtacagcaggccgtccatc
atggcacccagcactgccactacagttacacagatcaacggttcaacacacgtactcaag
tattctgtccttcacaacgggaaccacaaagagcaagaaaagaagcctctgcacatgaac
atagacttccacgagtcctgcttgtga

DBGET integrated database retrieval system