KEGG   Nothobranchius furzeri (turquoise killifish): 107382643
Entry
107382643         CDS       T05163                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nfu03000]
    107382643 (ahrr)
Transcription factors [BR:nfu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    107382643 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_9 PAS_3 RLL
Other DBs
NCBI-GeneID: 107382643
NCBI-ProteinID: XP_015810353
Position
sgr08
AA seq 688 aa
MIPPGDCMYAGRKRRKPIQKQKPSSANEKSNPSKRHRDRLNAELDRLASLLPFPPDVISK
LDKLSVLRLAVSYLRVKSFFQASQDKTSRKHITSTASSNPEPRKENLPLGATINESSLLL
ESLTGFALVVNNDGMVFYASSTIVDYLGFHQTDVMHQNIFDYIHIDDRQEFRRQLHWSMC
PPQYQGTSGQQDNQITAGTSEDFVVNSVFNSPEAGGIPPELSCFLNRCFVARVRCLLDST
SGFLTMQFQGRLKFLHGQKKKSPSGTSTPPQLALFCIAVPLLLPSIAEMKVKNILMRGKN
KGGGIMSAMEHGEHGEHLRRHSVNGGMGDITDPILFSHPGASQRGHHTPWTPICKENLKY
HSDGYYNQEEPLNYCKSSMAVHKGVGGGMGGGWHMRQHSGPIRAAQGVGYNTSNRLNRTG
QYEKTYRRSPSCHGGRGDEVFVSKLYGNVQIPADPDAYCVDLVKSENDYGECYNAHLMPD
VQPIKVEHDSDSDNGCDAYGQTWACRDQVSIDRHYGNGMYDPSSGLQLKSETNYYDAQYS
PCQRGKAGISPPYNSGTYPNYAINNNVGNAARLLKGDKDMGNNSDSSQYSPQKLSHSDSL
CNNQSTNLMDSNVYSHKAYMHLDYNKHGTYEFKGQGLIHSIKREPMDSPPWSGNGHDLNR
SMLVGSRNVMPCGMSTGHHKPSPYIYMQ
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgatccctccgggagactgcatgtacgcgggcagaaagaggaggaaacccatccagaaa
cagaagccatcctctgccaatgagaaaagcaacccatccaagcggcaccgggacaggctc
aacgcagagctggaccggctggccagcctgctgccgttcccgccggacgtcatctccaaa
ctggacaagctgtcagttctgcgtctcgctgtctcctacctccgtgtcaagagcttcttc
caagcgagtcaagacaagacttccaggaagcacatcaccagcacagcatcctctaaccct
gaacccaggaaagagaaccttccactaggcgccaccatcaacgaaagcagcctcctcctg
gaatctttgacaggctttgccttggtggtgaacaatgatgggatggttttctacgcttcc
tcaaccattgtggattatcttggatttcatcagactgacgtgatgcaccaaaacatcttt
gactacatccacatagacgaccgtcaggagttcagacgccagcttcactggtccatgtgt
cctccacaataccaggggacatctggtcaacaggacaatcagattactgcaggaaccagt
gaggactttgtggtgaacagcgtgttcaactctccagaggcaggaggaattcctcctgag
ctctcctgctttctcaacagatgcttcgtagccagggtgcgatgtctattggacagtacc
tctggtttcctgactatgcagttccaaggtcggttaaagttcctccatgggcaaaagaag
aagtccccctctggtacatcgacgcctccccaactggctcttttctgcatagctgtgcct
ctcttactgccctccatcgctgagatgaaagtgaaaaatatcttaatgcggggaaagaac
aagggaggagggattatgtctgcaatggagcatggtgagcatggggaacacctgagaagg
cactccgtcaatggtgggatgggggacatcacagaccccatcctgttttcccatccagga
gcttcgcagcgaggtcaccacactccctggaccccaatctgcaaagaaaacctcaagtac
cactctgatggctactacaaccaggaggagcccctcaattactgcaagtcctccatggct
gtccataaaggtgtagggggtggcatgggtggtgggtggcacatgaggcagcactcaggt
cccatcagagcagcccagggagttggatacaacacctcgaatcgcctgaatagaactggc
cagtacgagaagacttatcgccgttctccgagctgtcacggtggacgaggggatgaggtg
tttgtttccaagctctatgggaacgtccagattccagcagaccctgatgcttactgtgtg
gacctggtgaagagtgagaacgactatggagagtgctacaatgcccatttgatgccagat
gtgcaacccatcaaggtggagcatgactcggactctgacaacgggtgtgacgcatacggg
caaacttgggcttgtcgtgaccaagtttccatcgaccgtcactatggtaacgggatgtat
gatccaagctctggcttgcaactgaaatcagagaccaattattatgatgctcagtactca
ccttgtcagcgaggtaaagcaggaattagccccccatacaacagtggcacctatccaaac
tatgcaatcaacaacaacgtaggcaacgccgcgcgcctgctaaaaggcgataaagacatg
ggcaacaacagtgactccagccagtacagtcctcagaaactctcccactcagactctcta
tgcaacaatcaatctaccaacctcatggactcaaacgtatactctcacaaggcctacatg
cacctggactacaacaagcatggcacttatgagttcaaaggtcagggtctgatccattca
atcaagcgggagcccatggactcccctccctggtctgggaatggtcacgacctaaaccgg
tccatgctggtgggctccaggaacgttatgccgtgtgggatgagcacaggccaccacaaa
cccagtccttacatttatatgcagtaa

DBGET integrated database retrieval system