KEGG   Nothobranchius furzeri (turquoise killifish): 107384495Help
Entry
107384495         CDS       T05163                                 

Gene name
acox3
Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 3
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00071  Fatty acid degradation
nfu00410  beta-Alanine metabolism
nfu00592  alpha-Linolenic acid metabolism
nfu00640  Propanoate metabolism
nfu01040  Biosynthesis of unsaturated fatty acids
nfu01100  Metabolic pathways
nfu01212  Fatty acid metabolism
nfu03320  PPAR signaling pathway
nfu04146  Peroxisome
Module
nfu_M00087  beta-Oxidation
nfu_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    107384495 (acox3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107384495 (acox3)
   00592 alpha-Linolenic acid metabolism
    107384495 (acox3)
   01040 Biosynthesis of unsaturated fatty acids
    107384495 (acox3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107384495 (acox3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107384495 (acox3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    107384495 (acox3)
Enzymes [BR:nfu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     107384495 (acox3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 107384495
NCBI-ProteinID: XP_015813253
UniProt: A0A1A8TWW9
Position
sgr10
AA seq 692 aa AA seqDB search
MEKEEAFFPSGPLDVYRKKSSFSWRDMVHFIDGEDNVKFKQHVFQTLENDPLFARQPGED
IPMDKKRELNFLRMKQLFRYNFLTKEEMMADPRKAVILDDCLGMYDWALVAKFFLNLGMF
GSTIASSGSSRHNKYVKDTEDMTTFGCFALTELSHGSNTRAMRTTATYDPSTQEFVINSP
DFEAAKFWVGNLGKTATHAVVFAQLYTPDQVCHGLHSFVVPVRDPKTLLALPGVLVGDMG
KKLGQNGLDNGFVMFHGVRISRENLLNKTGDVTPDGRYLTPYKDPNKRFGASLGALSGGR
VYICRMALVNLKLALTVAVRFSASRRQFGPKDTEEIPVLEYQLQQWRLIPYLAAVYALDH
FTKTTFMNLIEFQVGQMMRDNSDRQAEMGKEIHAIGCSSKPLGSWTAQRGIQECREACGG
HGYLAMNRLGDLRDDNDPNCTYEGDNNVLLQQTSNYLLSLFYAKLHDGVRIQSPFHTVDF
LDDFQRILESRFTAQTVEECMNPEVSVTAYQWLVCFLLEESQKRLEQQKALGKDDFEARN
DSQVYYCRSLALIYIEHTCLQRFFELTTDPKTPAGLRSVLRRLCALYGLWSLNNHMATLY
QGNYVSGRRPAELVQMAILALCSELKDDAVALVDVFAPTDFILNSPAGNADGQLYKNMWS
AVMQGTQVLERPSWWKEFCSDKPVVGSLRSRL
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagaagaggcgttcttccccagcggtccacttgatgtttacaggaagaagagc
tcgttcagctggagagacatggtccacttcattgatggagaagacaacgtgaaattcaaa
caacacgtgttccagaccctggaaaatgatcctctgtttgctcgtcagcccggggaggac
atccccatggataagaagagagagctgaatttcctcaggatgaagcagctcttccgctac
aatttcctgacgaaagaagagatgatggcggacccgaggaaggctgttatcctggacgac
tgtcttggcatgtatgactgggctctggtggccaagttcttccttaacttagggatgttt
ggttccaccattgctagctcaggatcaagcagacacaacaagtatgttaaagacaccgaa
gacatgacgacttttggatgttttgctctaactgagctgagccatggcagtaacacccgg
gccatgagaacgaccgctacatacgacccatcgacccaggagtttgtcatcaactctcca
gactttgaggcagctaagttctgggtggggaacctgggtaagaccgccacccatgctgtg
gtgttcgctcagctctacacgcctgaccaggtgtgccatggcctccactcctttgttgtt
ccggtgagagatcctaaaacccttctagctctgcctggtgtgctggttggagacatgggc
aagaagttaggccagaacggactggataacgggtttgtaatgtttcatggtgtgaggatc
tctcgggaaaaccttctgaataagacaggagatgttactcctgacggccgctacctaaca
ccttataaggaccccaacaagcgttttggtgcatctttgggagccctgtcaggaggcagg
gtttatatctgcaggatggctctggtcaacttgaagctggctctaactgtagctgtccga
ttttcagcctccaggagacagtttggacccaaagacacagaggagatccctgttctggag
taccagttacagcagtggcgtctgattccctacctggcagcagtgtatgctctcgatcac
ttcaccaaaaccacctttatgaacctgatcgagttccaagttggacagatgatgagggac
aacagtgacagacaggcagagatgggcaaggagatccatgctattggttgctctagtaaa
ccactgggctcgtggaccgctcagaggggcattcaggaatgcagggaggcctgtggtgga
catgggtacctggccatgaaccgactgggagatctacgtgatgataatgacccaaactgc
acatatgaaggagacaacaacgtgttgttgcaacagaccagcaactacctgctcagcctg
ttttacgccaaactccacgatggtgttcggatccaatcgcccttccacactgtcgacttc
ctggatgattttcagaggatcctggaaagcaggtttacagcacaaacagtggaagagtgt
atgaaccctgaagtctctgtgacagcatatcagtggctggtgtgttttctgctggaggag
agtcagaagaggctggaacagcagaaagctttaggcaaggatgactttgaggcccgtaac
gacagccaggtctactactgcaggtcgctggctctcatctacatcgagcacacctgcctc
cagagatttttcgagctgaccaccgatccgaaaacgcctgcaggtctcagatcagtgctg
agaagactgtgtgccctgtatggactgtggagcctcaataaccacatggccacactttac
cagggtaattacgtgagtggaaggagacctgctgagctggttcagatggccatcctcgct
ctttgctctgagctgaaggacgatgctgtagctctggtggatgtttttgctcctaccgat
ttcatcctcaactcacccgctgggaatgctgatggacagctctacaagaacatgtggtcc
gctgtgatgcaggggactcaggtgctggagcgcccttcttggtggaaagagttctgctca
gacaaaccggtggtcggatccctccgatccagactttag

DBGET integrated database retrieval system