KEGG   Nothobranchius furzeri (turquoise killifish): 107384865Help
Entry
107384865         CDS       T05163                                 

Gene name
pik3c2b
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta isoform X1
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00562  Inositol phosphate metabolism
nfu01100  Metabolic pathways
nfu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107384865 (pik3c2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107384865 (pik3c2b)
Enzymes [BR:nfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     107384865 (pik3c2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 107384865
NCBI-ProteinID: XP_015813831
UniProt: A0A1A8V6I2
Position
sgr10
AA seq 1608 aa AA seqDB search
MSAAQTQKESTEAGWGCLESLGLSQKELVLAEALQMEYDALSRLKQDKNRTGPDQTGPRA
SHEIHCKTLNPPTERPRPTPSLHIPAPTEGNLLRGLSGSDSSLNQPGGSQYPLPLPARPT
PPHGVHVKESPYILDSPEVRKLRDVSGSSPGDSFGPGSGFLSKGLPALPDDVPPAIPPRH
PIPPASGSETPSLPPRPSTKPRDVNLFTPDVGHQKVTSAELDYDSIIDSLSRLSEDRTHL
RRADRETAGKPVARSKTLPPQVPPRTYTTIAKSNKNHRRVSAGPVSLSSRMNGFGYELFQ
VLEERDEEVAAFCHMLDVLRSAYPHSNYSTNAGFVWSPSVGHDELHQALGVSMKVTIISE
HFREPLTFTCDGSSTVDLLIYQTLCYAQDDLDHVNVDDYLLKVCGHEEFLNNSQTLAGLE
FVQQCLKFDWDIRLSLTKRSTINTKLARMKEDDDAPSSMNHCILLQERPVKQTVTREALT
LLLDTFHNEAESFVLSQVELSLHVERLVQSVKALCSSLAAVETPDVTAALNQLPACPCRL
QPKVLRDASVLAVKENRESVVEKLTAAILDLVELYCSTFNANFHTTLQSRSCMAPIQEAG
LVTNLLSFNVYAAHRIPITWATSYEGFFLSCSLTHGGVELCAPQHTSKQAISKYLFHLVV
WDQRVCFPVPINQLPRETQLTVTLHASLLPPPGGGEEKGKQWRSIEALGWVTMPLFNFRH
ILTCGRKLLGLWPSTPRRSGNARTSSPNFFQPDSVILQVDFPTSSFEVVFSTPPPADFCP
QYEFSRLDTTSQTQLQNVLKQKAFFWLTADDKRLLWEKRAYYQTESVALPLVLASAPCWQ
WACLPEIYALLRQWACLVHLDALGLLHASFPDQELRRTAVQWMDSISDTELLDYLPQLVQ
ALKYECYLDSSLVRFLLRRAIGDIRIAHYLFWLLKDNLQDSQFSARYQHLLAALLCCVGR
ALRDEFDRQCWLVSILTKVAQKVRDASPSSRQGALRESLEEMKQYFSINSCCRLPLNPAL
LVTGINIQSCSFFNSNAVPLKLSFQNLDPLGENINVIFKSGDDLRQDMLTLQMIRIMNKI
WIQEGLDMRMVIFKCFSTGRGRGMVEMIPHADTLRKIQVEHGVTGSFKDRTLADWLQKHN
PTDEQYDKAVENFIYSCAGCCVATYILGICDRHNDNIMLKTSGHMFHIDFGKFLGHAQMF
GNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDLCCEAYNLIRKHTHLFLNLLGLMLS
CGIPELSDLDDLKYVCDALRPNESEADATMYFTRLIESSLCSVATKLNFFFHNLAQMKFA
SSEDRLTLSFAPRVYTARSDGLIKNLFICRHIRTASTSKGYAFVVRVEREGQLEVQLVQR
TFEEFQELHSKLGLVFPSSKLPSFPSRLVIGRSRGEATADRRKDELNGYVWHLIHAAPEV
AQCDLVYTFFHPLPRDETGGASAKPAEVSWAPASGKELGEIKLSISYKNDKLFIMVMHIR
GLQPLQDGTDPDPYVKLYLLPDPMKMSKKKTKAARRTCNPTYNEMLVYDRIPRGDLDQRL
IHLRVLSDGAFWENTLLGQTFIHLNRLVPGQHWVDWHQLGGAGSDSAH
NT seq 4827 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcagcgcagacccagaaggagagcactgaggcgggatgggggtgtctggagtct
ttgggtcttagtcagaaggagctggttctggctgaggctctgcagatggagtacgatgcc
ctttccagactcaaacaggacaagaacagaactggacccgaccagactggacctcgagct
tcccatgagattcactgtaagaccctgaatcctccaaccgagcgaccccgacccaccccc
agcctgcacatccctgcccccacagaagggaacctgctgaggggactctctgggtccgac
tcctccctgaatcagcccgggggatcccagtaccccctccccctcccagccaggcccacc
cctcctcatggtgtccatgtcaaagagtccccctacattctggacagtccagaagtccgt
aagctcagggatgtctctgggtccagccctggggactcttttgggcctgggtcaggattc
ctgtccaaaggcctacctgctcttcctgatgatgttcctcccgccatcccaccaagacat
cccatccccccagcctcagggtcagagaccccatccctgcccccccggccatccactaaa
ccccgagacgtgaacctgttcacccccgatgtgggtcaccaaaaagtgacatcagcagaa
ctggactatgacagcatcatagattcactgtcccgactcagcgaggacagaactcacctg
cgccgcgccgacagagaaacagcagggaagcccgtggctcggagtaagaccctcccccct
caggtgcctcccaggacctacacaaccatagccaagagcaacaagaaccatcggcgggtt
tctgctggcccggtgtctctgagctccaggatgaatgggtttggatacgagctgttccag
gtgttggaggagcgagatgaagaagtggctgccttctgtcacatgctggacgtgttgcgc
tcagcatacccccacagcaactactcaacgaatgctggctttgtgtggtcaccttccgtt
ggccacgatgagctgcatcaggccctgggggtcagcatgaaggtgacgatcatcagcgag
cacttcagagaacctctgaccttcacctgtgatggctcctccacggtggatctgctcatc
tatcagactctgtgctacgctcaggacgacctggaccatgtgaatgtggatgactacctt
ctgaaggtctgcggacacgaagagttcctaaacaactctcagactttggcgggtctcgag
tttgtccaacagtgtctgaagtttgactgggacatccgtctgtctcttaccaagagatct
accatcaacaccaagctagcccgcatgaaagaagacgacgacgccccgtcctccatgaac
cactgcatcctgcttcaggagcgtccagtcaaacagactgtcaccagagaggcgctaacg
ctgctgctcgatacgtttcacaacgaagccgagtcctttgtgctgtcacaggtggagctt
tcgttgcatgtggaacgtcttgtccagtcagtgaaggcgctttgcagttcattagctgct
gtggagacgccagatgtgacggcggccctgaaccagctcccagcatgcccctgtcgtctg
cagcccaaagtcctgagggatgcttcagtgctggcggtcaaagagaacagagagtcggtg
gtggagaagctgacggcagccatcttggacctggtggaattgtactgcagcacgtttaat
gccaactttcacacgacgctccagagtcggagctgcatggcgccaatccaggaggctggc
ctcgtcactaacttgctgtccttcaacgtgtacgccgcccaccgcatccccatcacctgg
gccaccagttatgagggtttcttcctgtcctgctcactaactcatggaggggtggagctc
tgcgctccgcagcacacgagcaaacaggccatcagcaaatacctgttccacctggtggtg
tgggaccagagggtgtgttttcctgtcccgatcaaccagctgccccgggagactcagctg
acggtgacgctgcacgccagtctgctgcccccccctggaggaggcgaggagaagggaaag
cagtggcgcagcattgaggctctgggctgggtcaccatgccgctcttcaacttcagacat
atcctgacgtgtggcaggaagttactgggtctgtggccttcgacacccaggaggagcgga
aacgctcgcacgagttctcccaacttcttccagccggacagcgtcatcctgcaggtggac
ttccccacctcatccttcgaggtggtcttcagcactcccccccctgcagacttctgtcct
cagtatgaattcagtcggctggacactactagtcagacccagctgcagaatgtcctgaag
cagaaagccttcttctggctgacagcagacgacaagcggctcctgtgggagaagagggcg
tattatcagacagaaagtgtggcgctgcctctggttttggccagtgccccctgctggcag
tgggcgtgtcttccagagatctatgctctgctccgtcagtgggcatgtctggtgcacctg
gatgctcttggacttctgcatgcctcgttcccagaccaggagctgaggaggacagcagta
caatggatggactccatctcagacactgaactgttggactacctaccacagctggtgcag
gcgctgaagtacgagtgttacctggacagttctctggttcgcttccttctacggagagcc
atcggggacattcgtatagctcactacctcttctggttgctgaaggacaacctgcaggac
agtcagttcagtgctcggtaccagcacctcctggccgctctgctctgctgcgtgggtcgg
gctctgagggacgagttcgaccggcagtgctggctcgtctccatcctcaccaaggtggcc
cagaaggttcgcgatgcctcgccgtccagccggcagggtgccctcagggagagtttagag
gaaatgaagcagtacttctcaatcaacagctgctgcagacttcctctgaacccggcgctg
ctcgtaacaggaatcaacatccagtcctgttccttcttcaactccaacgccgtccccctg
aagctctccttccagaatctggaccctctgggagagaacatcaacgtcatcttcaagtca
ggagacgacctgcggcaggacatgttgaccctgcagatgattcgcatcatgaacaaaatc
tggatccaggagggtctggacatgaggatggtcatcttcaaatgtttctccactggcaga
gggcgaggtatggtggagatgattcctcatgctgacactctgaggaaaatccaggtggaa
catggagtcacaggatcgttcaaagaccgaacattggctgactggctgcagaagcacaac
cctactgatgagcagtatgacaaggcagtggagaacttcatctactcctgcgccggctgc
tgcgtggccacatacatcctgggaatctgtgaccgccacaacgacaacatcatgctgaag
accagtggtcacatgttccacattgactttgggaagttcctaggacatgcacagatgttt
ggaaacatcaaacgagaccgcgcccccttcgtcttcacctctgacatggcgtacgtcatc
aacgggggagacaaaccgtccagccgcttccacgactttgttgatctgtgctgtgaagca
tacaacctgatccgcaaacacacacacctgttcctcaacctgctgggcctgatgttgtcg
tgtggaattcctgaactctccgacctggatgacctaaagtacgtgtgtgatgccctgaga
cccaatgagtcggaggctgacgctacgatgtactttaccaggttgatcgagtccagtctc
tgcagcgtcgccaccaaactgaacttcttcttccacaatctggctcagatgaagttcgcc
tcgtcggaggatcggctcactctgtcgttcgcccctagagtctacacggcgaggagcgac
ggcctcatcaagaacctttttatctgcagacacatccgcaccgccagcaccagcaagggt
tacgcctttgtggtgagggtggagcgtgaaggtcagctggaagttcagctggttcagaga
acgtttgaggagtttcaggaacttcacagcaaactgggactcgtcttcccctcgtccaag
ctgcccagtttccccagccgtttggtgattggccgttcccgaggcgaggcgacagctgac
aggaggaaggatgagctaaacggctacgtgtggcacctaatccatgcggcgcccgaggtg
gctcagtgtgacctggtctacaccttcttccacccgctgcccagagatgagacaggagga
gccagcgccaaaccagcagaggtctcctgggctccagcttcaggaaaggagcttggtgaa
atcaaactatctatctcctacaagaatgacaaactctttatcatggtgatgcacatacga
ggcctgcagcccctgcaggatggcaccgaccctgacccttatgtgaagctctaccttctg
ccagaccccatgaagatgagcaagaagaagacgaaagctgcacgccgcacctgtaaccct
acctacaacgagatgctggtgtatgatcgcatccctcggggggatctggaccagcgcttg
atccacctcagggttctgagcgacggcgccttctgggagaacacgctgctggggcagacc
ttcatccatctgaacaggctggtcccaggtcagcactgggtggactggcaccagctgggt
ggggctggctcagactcggcccactga

DBGET integrated database retrieval system