KEGG   Nothobranchius furzeri (turquoise killifish): 107385384
Entry
107385384         CDS       T05163                                 

Gene name
rdh5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    107385384 (rdh5)
Enzymes [BR:nfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     107385384 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 107385384
NCBI-ProteinID: XP_015814708
UniProt: A0A1A7ZFA9
Position
sgr10
AA seq 348 aa
MFFQQPDNQKHTPETKMDTQFIYDLLGENAWYYIAATFAVLWILVWLYRDSLEIEDFSDK
YVFVTGCDTGFGNLLCKNLDRRGFHVLAGCLTEKGADDLKRATSPRLKTVPLNVTSLDSI
QKAMEWTKKEVGDKGLWGIVNNAGRSLPMGPSEWMRVEDYHSTLKVNMDGVIGMTTTFLP
LIKKARGRIVNVASVLGRVGANGGGYCISKFAVECFSDCLRRDIHYFGIKVCIIEPGFFK
TAVTNLDSLESELHRLWNQLSPEVKASYGEKYLDKFIKLQRLIMTVICDSDLTKVTSCME
HALTAAHPRARYSAGWDAKLLWIPISYLPSCMVDFALKLVLPRPSKSV
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgttttttcagcaaccagacaaccaaaaacacacacctgaaaccaagatggacacacag
tttatttatgatcttttaggggaaaatgcctggtattacatcgctgccacctttgcagtg
ttgtggattcttgtgtggctgtacagagacagcctggagatcgaggacttttctgataag
tacgtttttgtaactggctgtgacacggggtttggaaaccttctgtgtaagaatctggac
cgcagaggttttcacgttctggccggctgcctcacagaaaagggagccgatgatctgaaa
agagcgacaagtcctcgtttgaaaaccgtcccgctgaacgtgaccagtctggatagcatc
cagaaagccatggagtggaccaagaaggaggtcggtgataaaggactttggggtatagtg
aacaatgctggacgttcactacccatgggcccttcagagtggatgagagtggaggattat
catagcacgctgaaagtgaacatggatggcgtgatcggcatgacaacgaccttcctgcct
ctcatcaaaaaggcccgtggacggattgtaaatgtggcctcagtgctggggagggtaggg
gctaatggtggtggatattgcatctccaagtttgcagtggagtgtttctctgattgcctc
aggagagatatacactattttggtatcaaagtatgcatcattgagccgggatttttcaag
accgccgtgaccaatcttgattccctcgagagtgagctgcatcgtctgtggaaccagctc
agccctgaagtaaaagccagctatggagagaagtacctggataaattcattaagctccag
cgtttgatcatgaccgttatctgtgactcagacctcaccaaagtgaccagctgcatggag
catgctctgacagctgcccacccacgggctcggtacagcgctggctgggatgccaagctg
ctctggatccccatctcctacttaccttcatgtatggttgattttgcgctgaagctggtg
ctgccacgtccttccaagagcgtttaa

DBGET integrated database retrieval system