KEGG   Nothobranchius furzeri (turquoise killifish): 107385580Help
Entry
107385580         CDS       T05163                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107385580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nfu01001]
    107385580
Enzymes [BR:nfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107385580
Protein kinases [BR:nfu01001]
 Serine/threonine kinases: STE group
  STE20 family
   107385580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr Pkinase_fungal Kinase-like FTA2 Mrr_N
Motif
Other DBs
NCBI-GeneID: 107385580
NCBI-ProteinID: XP_015815078
Position
sgr01
AA seq 1238 aa AA seqDB search
MSRENTTRSLDSIDLASLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMEVTE
EEEEEIKLEINMLKSYSHHRNIATYYGAFIKKGPAGQDHQLWLVMEYCGAGSVTDLVKKT
KGSCLKEDWIAYICREVLRGLSHLHSHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDK
TIGRRNTFIGTPYWMAPEVIACDENPEATYDYRSDLWSLGITALEMADGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKRFLSFVDSCLIKNHLHRPTTDALLRHAFIRDLANERQVRI
MLKDHLDRTRKKREKEGPEYEYSGSEDEDDEVTEEEGEPSSIVNVPGEWTLRREFLRLQT
EDHQGGRGGQRQQALQQQAEQERYKQQILADRQRRIQLQQEQRQKLEDKQKQQLAERRFQ
WAELQEVFVGEESDLHDNRVDGRNRRCDWRQDQPIRLQSADVSLRPPDSTAEQRAAPANL
LLQHKVQQLQLQAKPQPVAQYQQPTAGRRSHRTLPKDQTQLLSLQHDHRQRDKDRQRDTP
AAAVQKQTAVSVQKAAAAASPRQPSVMELQESQLARVFLAAGLPSQMHSRLGSGSSSSPC
TPAMKRAQYSQNANLLSSRDTPHSSSMSDMALSPLSPLSPLSLTDDVFWDPAEMPPKVPE
RTTSKFYCRELVMGHKRTASSGSPVSPMEKTRAFVSQGGSPSNRNHPGYFQLESPLLHRS
LLQQKETDTRAHTQGVKVALGRLNKATERSSSSDEVGSSDDEDRNRSGLSNGKGKHFRRI
PDGIVLQPHRNLHQVSPLGLDDTYRLPDLVLKTSSSSPTDNTPSRQRTRELSYSLSPTAP
GSPTLQDLHAMSSPTGMSTSCSSSLSFIDPRLIPMSSPPLSPTGSKGEPLKRESHRKGSV
VNVNPTNIRPQSDTPEIRKYKKKFNAEVLCAGLWGVNLLVGTENGLWLLDRSGQGKVYSL
ISRRRFQQMDVLEGLNVLITISGKKNKLRLYYLSWLRNKILHNDPEVEKRLGWTSVGDLE
GCVHYKVVRYEKIKFLVIALKNAVEVYAWAPKPYHKFMAFKSFRALPQKPLSVDLTVEEG
QRLKVIYGSVSGFHAIDVDSGTPYDLYLPTHIQGSIRPHAVIILPNKAGTEVLVCYEDEG
VYIDTFGRITKDTVLQWGEMPTSVAYLQSNQVMGWGEKAIELRSANTGSLEGVFMHKKAK
KLKFLCERNDKVFFASVQSGGSSQIYFMTLGQNSLFSW
NT seq 3717 nt NT seq  +upstreamnt  +downstreamnt
atgtctagagaaaacaccactcgaagtttggacagtatagacctcgcttctcttagagat
ccagcgggcatctttgagctggttgaggtggttggcaacgggacctacggccaggtatac
aagggtcgccatgtcaagaccggtcagctggcagccatcaaagtcatggaggttacagag
gaagaagaagaggagatcaagctggagatcaatatgctgaagagttactcccaccacagg
aacattgctacttactatggtgccttcattaagaaaggtcctgctggacaggaccaccag
ctctggttggtgatggagtactgtggagcgggctctgtgacagacttggtgaaaaagacc
aaaggaagctgtctgaaagaggactggattgcctacatctgcagggaggtgctcaggggt
ctttcccatcttcactcccaccatgtgatccaccgggacattaagggacaaaatgtttta
ctcacagagaacgctgaggtcaaactggtcgactttggcgtctcggctcagctggataag
acgatcggtcgaaggaacactttcatcggtacgccatattggatggctccagaggtcatc
gcctgtgatgagaaccctgaggcaacatacgactataggagtgacctctggtctttgggc
atcaccgctttagagatggccgatggagccccccctctctgtgacatgcatccaatgaga
gcgctgtttttgattcctcgaaaccctccaccacggctgaagtcaaagaaatggtcgaag
cgttttttatcattcgttgacagctgcctgatcaaaaaccacctgcatcggccaaccacg
gacgctctgctgaggcacgccttcatcagagacctggctaatgagagacaggtgcgcatc
atgctcaaagaccacctggaccgaaccaggaagaagagagaaaaagagggtccggagtac
gagtatagtggcagtgaggatgaagacgatgaggtcacagaggaggaaggcgagcccagc
tctatagtgaacgttcctggtgaatggacgttgagacgggagttcctgcgtttacagacg
gaagatcatcaaggaggtcgaggaggtcaaagacaacaggcgctgcagcagcaggctgag
caggagcgatacaagcagcagattctggctgacagacagaggaggatccagttacaacag
gagcaacgacaaaagttggaggataagcagaaacagcagctggcagagcgtcgctttcag
tgggcggagcttcaggaagtgtttgtgggggaagagtctgatctccatgacaacagagtg
gatgggagaaacaggaggtgtgactggagacaggaccagcccatcagactgcagagtgct
gatgtatcattaaggcccccggactccacagcagagcagagagctgctcctgccaacctg
ctgcttcagcacaaggtccaacagcttcagctgcaagctaagcctcagcctgtagcccag
taccagcagcccacagcgggcaggaggtctcaccgcaccctgcccaaggaccaaacccag
ctcctgtcactgcagcacgaccaccgacagcgggacaaggacaggcagagggacacgcct
gcagcggccgtccagaagcaaacagctgttagtgtgcagaaggctgctgcagcagcttca
cccagacagccctcagtgatggagctgcaggagtctcagctggccagggtgtttttggct
gctgggctgcccagccagatgcactcaaggctgggctctggaagcagctccagtccttgt
acaccagccatgaagagagctcagtatagccagaatgccaatctcctctccagtcgagac
acccctcacagcagctccatgtcagatatggccctctcccccttgtccccgttgtcccct
ctgtccctgacagatgatgtcttctgggacccggctgagatgccacctaaagtcccagag
cgcaccacttctaaattttactgcagagagcttgtgatgggacacaagaggacggcttca
agtggcagtccggtgtctccgatggagaagaccagagccttcgtgtcacaaggaggctcc
ccttcaaacaggaaccacccaggttacttccagctggaaagtcctctcctacaccgcagt
ctgctgcagcagaaggaaacagacaccagagcgcacacacaaggagtcaaagttgctctg
ggtcggctcaacaaggccacagaacgctcctcttctagtgacgaggtcggcagcagcgat
gatgaggacagaaacaggtctggcctgtccaacggaaaaggcaaacacttccgaagaata
ccagatggcatcgtcctgcagccccaccgtaatctccaccaggtgtcccctctgggtttg
gacgacacctaccgtctgccagacctggtgctgaaaacctcgtcctccagtccgactgat
aacaccccgagccgccagcgcacacgtgaactcagctactcgctgtcccccacagctccc
ggatcgcccacgctgcaagatctgcatgctatgagcagtcccactggaatgagcacctcg
tgctcctcctccctgtccttcatcgacccaagactgatccccatgtcgtcgccaccgctc
agtcccacaggcagcaaaggtgagccactgaagagggagagtcacaggaagggctccgtg
gtgaacgtgaacccaaccaacatccgacctcagagtgacacgccagagatccgcaagtac
aagaagaagttcaacgctgaggttctgtgtgctggactttggggagtgaacctgctggtg
ggtacagaaaatggcctttggctgctggatcgaagcggacagggaaaagtctactctctc
atcagcagacggaggtttcagcagatggatgtcctggagggactcaatgtcctcattaca
atatcaggaaaaaagaacaagctgcgtctgtactacctgtcctggttaaggaataagatc
ctccacaacgacccagaggtggagaagagactaggctggacctcagtgggggacttggag
ggttgtgtacactataaagtggtgagatacgagaagattaagttcttggtgattgctctg
aagaacgccgtggaggtctatgcctgggcccccaaaccctatcacaagttcatggccttc
aagtccttcagggccctgcctcaaaaaccattatctgttgacctgacggtggaggaagga
cagaggttaaaggtcatctacggctctgtgtctggtttccatgccatcgatgtcgactct
ggaaccccgtatgatctctacctgcctacacatattcagggctccatccgtcctcacgct
gttatcattttaccgaacaaagctggaacagaggtcctggtgtgctacgaagacgaaggc
gtctacattgacacatttggacgcatcaccaaggatacggtgctgcagtggggggagatg
cctacatcagtcgcctaccttcagtccaaccaggtgatgggttggggagagaaggccatt
gagttgaggtcggccaacaccgggagcctcgagggagtcttcatgcacaaaaaggccaaa
aaactcaagtttctgtgtgagaggaacgacaaggtgttctttgcctcagtgcagtcagga
ggcagcagtcagatctacttcatgactctcggacagaattcgctcttcagctggtga

DBGET integrated database retrieval system