KEGG   Nothobranchius furzeri (turquoise killifish): 107386671
Entry
107386671         CDS       T05163                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00100  Steroid biosynthesis
nfu01100  Metabolic pathways
Module
nfu_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    107386671 (tm7sf2)
Enzymes [BR:nfu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     107386671 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 107386671
NCBI-ProteinID: XP_015816694
Position
sgr11
AA seq 432 aa
MLERCSKMGPNSKALKQKLSQDTEREFGGTLGAVCIPFFLPLTVLFLICVSRSPEASVLQ
WPPQLPSTDQLWDPLAPVILLGWIGLHTLLYFMPFGKVSEGLTLRDGTRLQYPINGFHSL
CASSVLLVLLLGLGVPIGYLFELLLPLAASAIAASFLLSIYLYVRSFWAPYHALALGGNT
GNPLYDFFIGRELNPRIGNFDLKYMCELRPGLIGWVVINLGMLMKEVELRGSPSLAMILV
NSFQLLYVADALWNEEAVLSTMDIVHDGFGFMLVFGDLAWVPFTYSLQAAFLVGHPQALT
LLKAAAIVALNGIGYYIFRKSNSQKNQFRRDPTHPSVAGLETIATAMGKRLLVSGWWGFV
RHPNYLGDLLMALAWSLPCGFSHILPYFYIVYFTVLLIHREARDERQCRAKYGQAWDTYC
RRVPYRIFPYIY
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgttagaaaggtgctcaaaaatgggaccaaacagcaaagcactgaaacaaaaactgtct
caagatacagaaagggagttcggaggaaccctaggcgctgtatgcattccattttttctt
ccattgacggtactcttcctgatctgtgtgagtcggtctcctgaagccagtgtgctccag
tggccccctcagctcccctccactgatcagctgtgggaccctctggcccctgtgattctg
ttgggatggatcggtctgcacaccctcctctattttatgccatttggaaaggtatctgaa
ggactaacgctgagggatggaacacgcctccagtatcccataaatggttttcacagtctg
tgtgccagctctgtgttgctggtgttgttgctggggctcggggttcctatcggatatctg
tttgaactgctgttgcctctggcagcgtctgccatagctgcgtcgttcctgctctccatc
tacctctacgtacgctctttttgggctccctaccatgctttggccctggggggaaacaca
ggaaatcccttgtatgacttcttcatcgggcgggagctaaacccacgaattggaaacttt
gatttaaaatatatgtgtgaactcagaccaggtctgattggctgggtggtcattaacctc
gggatgctgatgaaggaggtggagcttcgaggatctccctctctcgccatgatcttggtc
aacagtttccagctgctctatgtggccgatgctctgtggaacgaggaggcagttctgtca
accatggacattgttcatgatggttttggtttcatgctggtctttggtgacctagcctgg
gtccccttcacatacagtctgcaggcagccttcctggttgggcacccacaggctctgact
ctccttaaagcagcagcaatagtagcgctgaatggaatcggatattatatctttagaaag
tcaaactcacagaagaaccagttcagaagagacccgactcacccgagtgtagcaggtttg
gagactattgccacggcgatggggaaacggctgcttgtgtctggctggtggggttttgtt
cgtcatcctaattacctcggcgaccttctcatggctctggcgtggtctctgccgtgcgga
ttctcacacattttgccatacttctacattgtttacttcaccgtcctgctgattcaccgg
gaggcccgtgacgagaggcagtgcagggccaaatatggacaggcgtgggacacttactgc
cgccgggtcccctacaggattttcccttatatttactga

DBGET integrated database retrieval system