KEGG   Nothobranchius furzeri (turquoise killifish): 107387703Help
Entry
107387703         CDS       T05163                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13-like
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04270  Vascular smooth muscle contraction
nfu04371  Apelin signaling pathway
nfu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107387703
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107387703
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107387703
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nfu04147]
    107387703
   04031 GTP-binding proteins [BR:nfu04031]
    107387703
Exosome [BR:nfu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107387703
  Exosomal proteins of colorectal cancer cells
   107387703
GTP-binding proteins [BR:nfu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    107387703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA MMR_HSR1 FtsK_SpoIIIE AAA_29
Motif
Other DBs
NCBI-GeneID: 107387703
NCBI-ProteinID: XP_015818304
Position
sgr12
AA seq 377 aa AA seqDB search
MADFLPTRSVLKVCLPFCVLSNAEADQIRKSKEIDKGLNREKTHVKRLVKILLLGAGESG
KSTFLKQMRIIHGDDFDAKAREDFRSTIYSNVIKGIRVLVDAREKLHIPWGDPNNQPHGD
KVMAFDTRSAKMVNGQVDRQVFYEYVVAIKALWADSGIQNAYDRRREFQLGESVKYFLDN
LDRLCEANYLPSQQDILLARKPTKGIHEYNFEIRNIPFKMVDVGGQRSERRRWFECFDSV
TSILFLVSSSEYDQVLMEDRQTNRLRESLNIFETIVNNRVFGNVSIILFLNKTDLLEEKV
KIVAFKDYFPEYTGKEHDLSDVQCFMVDCFRAKRRIVSQKPLYHHFTTAINTENIRLVFR
DVKDTILHENLIQLMLQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttcctgccgaccaggtctgtgttaaaagtttgtctacccttctgtgtgctc
agcaacgcagaggcggaccagatacgaaagtctaaagagatcgacaaaggtctgaaccgg
gagaagacgcatgtgaaacgcttggttaaaatccttctgctgggcgctggcgagagcggc
aagtcgactttccttaaacaaatgcggatcatccacggcgatgacttcgacgcgaaagcc
cgagaagacttcagatcaacgatttacagcaacgttattaaaggtatccgtgtgttggtg
gatgcacgggagaagctacacatcccttggggtgacccaaacaatcagccgcatggggac
aaagtgatggcttttgacacccgctcggccaagatggtgaatgggcaggtggacaggcag
gtgttttatgagtatgtggttgccatcaaagcactgtgggcagactcgggtatacagaat
gcctacgatcgtcgcagggagtttcagctgggtgagtcggtgaagtatttcttggataat
ctggataggctctgcgaggcgaattatctccccagtcaacaggacatcctgctggctcgt
aaacccaccaagggcatccacgagtacaactttgagatcaggaacattccttttaagatg
gtagacgtgggggggcaacgatcagagcggagacggtggtttgaatgtttcgactccgtc
acttccatcctcttcctcgtctcttcctctgaatatgatcaggtgctgatggaggacagg
cagaccaaccgccttcgtgaatcactcaacatctttgagacaatcgtcaacaaccgagtc
tttggcaacgtttccattatccttttcctgaacaagacggatctgctggaggagaaggtg
aaaatcgttgctttcaaagactactttcccgaatacaccggaaaggaacatgacctgtca
gacgtccagtgtttcatggtggactgcttccgagccaagagacgcatcgtctcacagaag
cctctgtaccaccacttcaccacggccatcaacactgagaacatcaggctggtgttccgg
gatgtcaaagacaccatcctccatgaaaacctcattcagctcatgcttcaatga

DBGET integrated database retrieval system