KEGG   Nothobranchius furzeri (turquoise killifish): 107388500Help
Entry
107388500         CDS       T05163                                 

Gene name
irak4
Definition
(RefSeq) interleukin-1 receptor-associated kinase 4
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04620  Toll-like receptor signaling pathway
nfu04621  NOD-like receptor signaling pathway
nfu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107388500 (irak4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107388500 (irak4)
   04621 NOD-like receptor signaling pathway
    107388500 (irak4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107388500 (irak4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nfu01001]
    107388500 (irak4)
Enzymes [BR:nfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107388500 (irak4)
Protein kinases [BR:nfu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   107388500 (irak4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Death Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 107388500
NCBI-ProteinID: XP_015819558
UniProt: A0A1A8UG45
Position
sgr13
AA seq 461 aa AA seqDB search
MEKSLTSATYLRNISYDLRRALSDFLDPQDRWKDVIVSIRKPGGEPRYSQLHVRRFEGLV
AQGRSPTVELLNDWGTTNSTVGELVDILKSRDLLAAACLFLPVEEVFPAETKQLSAAPPA
PPTRLLGEAETPPPSSSSDPQTQLLQADRETGHTGFSSFSYRELMRITGNFDDRSISNGG
RRLGMGGFGTVYKGFLNVIAVAVKKLNPVEDMPLDKLKVQFDQEIQTLKVLKHENLVDMI
GFSCDEQQLCIVYAFMANGSLLDRLACLDGSPPLSWRQRCLIAEGTARGLEYLHLNHHVH
RDVKSANILLDENLVAKISDFGLTRASAKHTSTTMMTERIVGTRAYMAPEALRGEVTPKS
DVFSFGVVLLEILSGLAPANENKEPQLLMEIRYDIDDEDEELTLEDFVDKKMSDWELSQV
ETIYCLASNCLHDRKNRRPVIKQVVSEIRSVVKNVSLDAQK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggagaagtcgctgacttccgctacttatctccgcaacatcagttacgacttacgtcgc
gcgctgtctgactttttggacccacaagacagatggaaagacgtgattgtgtccatacgg
aagccgggcggtgagccgcggtactcccagcttcatgtcaggaggtttgaggggcttgtg
gcccagggcaggagtcccactgtggagctgctgaacgactgggggaccaccaacagcact
gtaggagaactggtggatattctgaagagtcgtgatctactggctgctgcctgcctcttc
ctcccagttgaagaagttttcccagctgaaacaaagcagctctctgcagcaccaccagct
cctccaaccaggctgctgggggaggcagagactcccccaccgtcctccagctctgaccca
cagacgcaattactgcaggcagaccgtgaaacaggacacaccggtttctccagtttctca
tacagagagctgatgaggatcactgggaactttgacgaccgctcaatatcaaatggaggt
cgccgtcttggaatggggggctttggaacggtctacaaaggtttcctgaatgtcatagct
gtggcagtgaaaaaactcaatccagtggaagacatgccgctggacaagctgaaagttcag
ttcgaccaagaaatccaaactttgaaagtgttgaaacatgagaacttggtcgacatgatt
ggattttcctgtgatgagcagcagctgtgtatcgtatacgccttcatggcgaacggatct
ctgctggatcgactagcctgcttggacggaagtcctcccttgtcctggagacagaggtgt
ttgatagcagaggggacagccagagggttggagtacctacacctgaaccatcatgtacac
agggatgtcaaaagtgcaaatatcctgttagatgaaaatcttgtggcaaaaatctcagac
tttggcctcacaagagcttcggccaagcacacctcgacaaccatgatgacagagaggatt
gtgggtactcgtgcatatatggcacctgaggcactgagaggagaagtcacccccaaatct
gacgtcttcagctttggtgtggtgctgttagaaatattatctggactcgctccggccaat
gagaacaaggagcctcagctgctgatggagatcaggtacgacatcgatgatgaagatgaa
gagctgactctggaggattttgtggataagaagatgagcgactgggagctgagccaggtg
gagaccatctactgtttggcttcgaactgcttacatgaccgaaagaacagacggccggtc
atcaaacaggttgtgtcagagatccgcagcgttgtcaagaatgtttctctggatgctcag
aaataa

DBGET integrated database retrieval system