KEGG   Nothobranchius furzeri (turquoise killifish): 107389780
Entry
107389780         CDS       T05163                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:nfu03021]
    107389780 (aff3)
Transcription machinery [BR:nfu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     107389780 (aff3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 107389780
NCBI-ProteinID: XP_015821617
Position
sgr14
AA seq 1185 aa
MTQSWPSQQALVGDQQIFYNSKDAKQSSGQQRQNRGDAPLRMPRHPYVAPHKSMLADDLK
LSSDDDDTQRAINESTSWARHSLSAKRAHTHGRRVRHSSSDSSDSDSSAESGSSSVPSRS
PSPEVHPGPLSPANPLPPCNDKETDHPSPTQWQLDKWLKRSKKNSGSTERNHSWKVPERQ
RSPQIQRAPSPARSWDSHQEYSPSQSPIPSPKFNHSPNNSPIPSPGYSYCPSPSPFTSTC
PSPTPSPRHISVPSPARSLCPSPCGSPRASRSPSPLPNHPPRSPSPTLRTPTRISHYLDG
QNQIQGHSSLTSDPHRTRIRPWFAPVPAINTKTTTTSDHHQPSHQHRPKTHPSQNQVKNQ
SRLTAPVVLTSNQTHNHNPTPRPTSYSNAKQPSDAHKAKNTSHVDQIQINPSNHKSRPPF
QQPNPTRPKHPVSSGREARAAHSSLSQPTYKATNTSGVASSSRSSPSQVHRSKSWESTVS
NSVHVNNSKTAVRKLPAKAQEVNQRRSSLNQSEGRKQERKEDRHNCEKQRGKPERKEDRR
LAEEQLLRRPWIQSSAEEEEEEDVIEQQGGRDEAAKEESRRKEEQLNKWLTALAKDRGPA
NFERHRLREGSDHQERTTKRGRCEEDRGPSPHLSSHSPPNPHRLSSSPPSSSTSSSNSDS
ESEFLISTAKVSADSISHKTFSKKGQQVPSRPNAPRPQAVHSRGPNSGPPCEGQQSERKQ
KLYTLVPFGRSEKAAPTSQRGLRNLVVHIDLCLLKRVPDSSTNSPVKKNTSSSSSSSTKD
RQREVMKHTHVPDASTKDGKRKRKVENGVSDRECKRSQLYPDDPPGPTESSVTAETLVTE
TMHNGYLEEYLDKRPMSPLSPLSPLSPLPQSPEPTKPTSKTKTTEQQNSRTQKSKEKSRD
QPVKPKMEVECVKVSKQPQPSSESSWRPADHRGAVPHETSHHAEYYLHEAKRMKHRADAM
VDKLGKAVNYVDAALSFMECGKAMEEGPLEAKSPYTMYSETVELIRYAMKLKSHSGPGAR
QEDKQLAVLCFRCLALLYWQMFRLKKDHALKYSKVLLDYFKSSPKVPTTPPGWNDCGKSM
GEHPSSLSPNARHRRRDPPGGSSSSLISIPQRIHQMAANHLNITNSVLYSYEYWEVADNL
AKENKEFFNYLNTLSGPLTIHSSVAHAVQYTRQALQWIRISAKLN
NT seq 3558 nt   +upstreamnt  +downstreamnt
atgactcagtcctggccatcccagcaggcgttagtgggtgaccagcaaatcttctacaac
tccaaggatgcaaaacaatcatctggacagcaaaggcaaaatcgaggggatgctccactc
cgaatgccccgtcacccttatgtggcacctcacaaatcgatgctggctgatgatctgaag
ctgagcagtgatgacgatgacactcaaagggccattaatgagtcaacatcgtgggcgaga
cacagcctgtcagcaaagcgagcacacacacatggcaggcgggtgagacattccagctct
gactcctcagactctgactccagtgccgaatcgggcagcagcagcgttccttctcggagc
cccagtccagaagtgcacccaggtcccctgtcgcctgccaacccgctgccaccgtgcaac
gacaaagagacagatcacccctctcctacccaatggcagctagataaatggctgaagagg
tcaaagaaaaactctggcagcactgaacggaatcactcctggaaggttccagaacgccag
cgatctccccaaatccagagagccccatcgccggctagatcatgggacagccatcaggag
tacagccctagtcagagtccaatacccagcccaaagttcaatcacagccccaacaacagc
cccattcccagtcctggttacagctactgcccaagccccagcccattcactagcacctgt
ccaagccccacccccagtccaagacacatttcagtcccaagcccagctcgaagcttgtgt
cccagtccatgtggaagcccaagagccagccgtagcccgagccctttaccaaatcatcct
ccaagaagcccaagtcccactttacgtacaccgaccagaattagtcactaccttgatggt
cagaatcagatccaaggacattccagtctgacatctgacccccacaggacaagaattaga
ccatggtttgctccagtacccgccatcaacacaaagacaacaaccacaagtgatcatcat
caaccatcgcatcaacatagacccaagactcacccatcacagaaccaagtcaaaaaccaa
agcaggctcactgctcctgtagttttaacctccaatcagacccacaaccacaatcccaca
cctagaccaacttcatattccaacgcaaaacagccatctgatgctcacaaagctaaaaac
acatcacatgttgatcaaatccaaattaacccttccaaccacaagtcacggcctccgttt
cagcagccaaatccaaccagaccaaagcatccagtttcttctggtcgagaagccagagct
gctcacagttctctttcacaacctacctataaagctacaaatacctctggtgttgcatca
agctctaggtccagtcctagccaagtgcatcggtcaaaatcgtgggagtccacggtatca
aactctgttcatgtaaataactcaaaaactgcagttcggaagcttccagccaaggcacag
gaagtaaaccagagaagatcgagtttgaaccaatcagagggtagaaaacaggagagaaag
gaggacagacataattgtgagaaacaacgggggaaaccagagagaaaagaagacaggagg
ctggcggaggagcagctactgagacgaccctggatccaaagctcagcggaagaggaagag
gaagaggacgtgatagagcaacagggtgggagagacgaggcagcaaaagaggagagcagg
agaaaggaggagcagctaaataaatggctaacagctctggccaaagacagagggcctgcc
aactttgagagacaccgccttagagagggctcagaccatcaggagaggacaaccaagaga
gggagatgtgaggaagacagaggcccatcgccccatctgtcttcacactctcctccaaac
cctcacagactgtcctcatcaccaccctcatcctccacctcttcttctaattcagactca
gaatctgaatttcttatttcaaccgccaaagtttcagcagattccatctctcacaagaca
ttcagcaagaaagggcaacaagtccccagcagacccaacgccccgaggccccaggcggtt
cactccagaggaccaaactcgggccctccttgtgaggggcagcaaagtgagaggaagcag
aaactctacaccttggttccatttggacgaagcgagaaggcagctcccacctcccagcgg
gggctgagaaacctggtggtgcacattgacctctgtcttctaaaaagggtccctgatagc
tcaacaaattcccctgtaaagaaaaacacttcttcctcatcttcttcatcaaccaaggac
aggcaaagagaagttatgaaacacacgcacgttccagatgcttcgacaaaagatggcaaa
aggaaacgcaaggtggagaacggagtgtcagaccgggaatgcaagaggagtcagctttat
ccagatgacccccctggaccaacagaatcatcagtcacagctgagactttagtgactgag
acgatgcacaatgggtacctggaggagtacttggacaagaggccaatgtctcccttgtct
ccattgtctccattgtctccgctgccccagagccctgaacccaccaaacctacctccaaa
acaaagacaactgagcagcagaactctcgcacccagaaaagcaaggagaagagcagagac
cagcccgtcaagcccaagatggaggtggagtgtgtaaaagtatcaaaacaaccccaacct
tcgtccgagtcctcctggagacctgctgaccacagaggagctgttccgcatgaaacttct
caccatgctgagtactacttacatgaagctaaaaggatgaagcaccgtgccgatgcaatg
gtggataagttgggaaaagctgttaactatgttgatgctgctctgtccttcatggaatgt
gggaaggcgatggaggaagggccgctggaggccaagtctccttacaccatgtattcagag
acggtggagctgatcaggtacgccatgaagctgaagagccactcgggccctggagcaagg
caggaagacaaacagctggcggttctgtgtttccgatgccttgctctcctttactggcag
atgttccgtttgaaaaaggatcatgcgctgaaatactccaaagtgctgcttgactatttc
aagagttctcccaaagtgcctacaacaccacctggttggaatgattgtgggaagagcatg
ggagaacacccgtcttcactctcacccaacgccagacaccgcagaagggacccacctggt
ggcagcagctcatctctcataagcattccccaacgcatccaccagatggcagcaaaccac
ctgaacatcaccaacagtgtcctgtacagttatgagtactgggaggtagcagacaacctt
gcaaaggaaaataaagagttcttcaactacttgaataccttgtctggacctttgactatt
cacagcagcgttgctcatgctgtccagtacaccagacaagctcttcagtggatacgcatc
agtgccaaacttaattaa

DBGET integrated database retrieval system