KEGG   Nothobranchius furzeri (turquoise killifish): 107390214Help
Entry
107390214         CDS       T05163                                 

Definition
(RefSeq) histamine N-methyltransferase-like isoform X1
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00340  Histidine metabolism
nfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    107390214
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nfu04147]
    107390214
Enzymes [BR:nfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     107390214
Exosome [BR:nfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107390214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_16 Methyltransf_28
Motif
Other DBs
NCBI-GeneID: 107390214
NCBI-ProteinID: XP_015822293
Position
sgr14
AA seq 314 aa AA seqDB search
MNPNKIPTGILRDTNRFEPIMASPLMSLVHDDDRYQKSFQLFLERSSEHQCMKDFIHNKL
PHILASIGDGKSHLNVIEVGSGAGDIDLEMLSELHKKHPEVTIDNEVVEPSSQQLHHYQV
LVSQKPELNYTKFTWNKMTASEFEENWKQKKMTKKADFVHMIQMLYYVKDLGATISFFQS
LLDKNGKLIITLVSDKGGWGKLCQKYRNQLCSTGISYCVTTRDIRCFLDSKGVSYQSFDL
PSHMDITECFTEGDEKGELLLDFLTEVLDFSKTASPELKAGVLELLRHPDCSSRSEDRVV
FIYNLEAIVIDEPT
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgaataaaatcccgacaggaatcctgcgagacacgaacaggtttgaacccatc
atggcttcccctctgatgagtctggttcatgatgatgacaggtaccagaagtccttccag
ctcttcctggagcgctcctcagagcatcagtgtatgaaggacttcatccacaacaagctg
ccacacatcctggccagcattggagatggaaagtcccatctaaatgtgattgaggttgga
agtggagcaggtgacattgaccttgaaatgctctcagagctccacaagaagcacccagaa
gtgaccatcgataacgaggtggtggagccaagcagccaacagttacatcactatcaagtt
ttagtgtctcagaaaccagaattaaactacacaaagttcacctggaacaagatgacagcc
tcagagtttgaggagaactggaaacagaagaagatgacaaagaaggcagacttcgttcac
atgatccagatgctgtactatgtgaaggatctcggcgccaccatcagcttcttccagagt
cttctcgataagaacgggaaacttattataactctagtgtctgataagggtggctggggg
aaactgtgccagaaatacaggaaccagttgtgcagcacaggaataagttattgtgtaacc
acaagagacatcagatgcttcctggactccaagggagtgagctaccagagctttgacctg
ccctctcacatggatatcaccgagtgtttcactgagggagatgagaagggagagctgctt
cttgatttcctcaccgaggtgctggactttagtaaaaccgcctcgccggagctgaaagcc
ggtgtgttggagctgctgcggcacccggactgcagctcccggtccgaggacagagttgtt
ttcatctacaacctcgaagccatcgttattgatgaaccaacctaa

DBGET integrated database retrieval system