KEGG   Nothobranchius furzeri (turquoise killifish): 107390748Help
Entry
107390748         CDS       T05163                                 

Gene name
pgd
Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00030  Pentose phosphate pathway
nfu00480  Glutathione metabolism
nfu01100  Metabolic pathways
nfu01200  Carbon metabolism
Module
nfu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
nfu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    107390748 (pgd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107390748 (pgd)
Enzymes [BR:nfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     107390748 (pgd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     107390748 (pgd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 NAD_binding_11 F420_oxidored CoatB
Motif
Other DBs
NCBI-GeneID: 107390748
NCBI-ProteinID: XP_015823123
UniProt: A0A1A8UB53
Position
sgr15
AA seq 483 aa AA seqDB search
MAKADIALIGLAVMGQNLIMNMNDHGFVVCAYNRTVSKVHDFLQNEAKGSKVIGAESLED
MVSKLKKPRRIILLVKAGQAVDDFIDKLVPLLEAGDIIIDGGNSEYRDTTRRCKSLKEKG
LLFVGSGVSGGEEGARYGPSLMPGGHKEAWPHIKDIFQSIAAKVGTGEACCDWVGDEGAG
HFVKMVHNGIEYGDMQLICEAYHLMKDVLGMDHDEMAQAFDSWNKTELDSFLIEITANIL
KYRDTDGAHLLPKIRDSAGQKGTGKWTAISALEYGTPVTLIGEAVFARCLSSLKDERVQA
SRSLSGPQGVKFSGNKATFLEDIRKALYASKIISYAQGFMLLRQAAIEFGWSLNYGAIAL
MWRGGCIIRSVFLGKIKEAFDRDAELQNLLLDNFFCDAVQDCQESWRRTVGVGVQHGIPM
PCFTTALSFYDGYRHDMLPANLLQAQRDYFGAHTYELLTKPGHFIHTNWTGHGGNVSSSS
YNA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcagacatcgcactgattggtctggctgtcatgggccagaacctcatcatg
aacatgaacgatcatggctttgtggtctgtgcgtacaaccgaaccgtgtccaaggtgcac
gacttcctgcagaatgaggcaaagggctccaaggtgatcggagctgagtctctggaggac
atggtgtctaagctgaagaagcccaggaggatcatcctgctggtcaaggctgggcaggct
gtggacgacttcattgacaaactggttcctcttctagaagctggggacatcatcatcgac
ggcggcaactctgaatacagagacacaacacgtcggtgtaagagtctgaaagagaagggc
ttgctgtttgttgggagcggagtgagtggtggagaggagggagcacgctacggaccctca
ctcatgccaggaggacataaagaggcctggccgcacattaaagacatcttccagagcatc
gctgccaaggttggaacaggagaggcgtgttgtgactgggttggagatgaaggtgcaggt
cattttgtaaaaatggtccataatggcatcgagtatggagacatgcagctgatctgtgag
gcctaccacctaatgaaggatgttctggggatggaccacgatgagatggcacaggctttt
gatagctggaacaagacggagctggactccttcctgattgagatcacagccaacatcctt
aaatacagagacaccgatggcgcacatctgctgcccaaaatccgggacagcgctggacag
aaaggcacggggaagtggacggccatttccgccctggagtacggcacgcccgtcactttg
attggggaggccgtcttcgccagatgcttgtcgtctttgaaggatgagagggttcaggcc
agccgcagcctctcaggaccgcagggggtcaaattcagcggcaacaaggctacgtttctg
gaggacatcagaaaggccctctatgcctccaagatcatttcctacgctcagggcttcatg
ctgctgcggcaagcggccatagagttcggctggtcgcttaactacggcgcgatcgctctg
atgtggagaggagggtgcatcatcagaagcgttttcttgggtaaaatcaaagaagcgttc
gacagagacgctgagctgcagaacttgttgctggacaatttcttctgtgatgctgtgcaa
gactgtcaggagtcctggcgcagaacggttggtgtgggagtgcagcacggcatcccgatg
ccctgcttcaccacagctctgtccttctacgacggttacagacacgacatgcttcctgcc
aacctgctgcaggcccagagggactattttggtgctcacacatacgagctgctaactaaa
cccggacatttcatccacaccaactggacgggccatggtggaaacgtctcctcttcctcc
tacaacgcttaa

DBGET integrated database retrieval system