KEGG   Nothobranchius furzeri (turquoise killifish): 107391338Help
Entry
107391338         CDS       T05163                                 

Definition
(RefSeq) mitogen-activated protein kinase 12-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04068  FoxO signaling pathway
nfu04114  Oocyte meiosis
nfu04218  Cellular senescence
nfu04261  Adrenergic signaling in cardiomyocytes
nfu04370  VEGF signaling pathway
nfu04620  Toll-like receptor signaling pathway
nfu04621  NOD-like receptor signaling pathway
nfu04622  RIG-I-like receptor signaling pathway
nfu04625  C-type lectin receptor signaling pathway
nfu04912  GnRH signaling pathway
nfu04914  Progesterone-mediated oocyte maturation
nfu04933  AGE-RAGE signaling pathway in diabetic complications
nfu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107391338
   04370 VEGF signaling pathway
    107391338
   04068 FoxO signaling pathway
    107391338
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107391338
   04218 Cellular senescence
    107391338
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107391338
   04621 NOD-like receptor signaling pathway
    107391338
   04622 RIG-I-like receptor signaling pathway
    107391338
   04625 C-type lectin receptor signaling pathway
    107391338
  09152 Endocrine system
   04912 GnRH signaling pathway
    107391338
   04914 Progesterone-mediated oocyte maturation
    107391338
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107391338
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107391338
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107391338
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nfu01001]
    107391338
Enzymes [BR:nfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107391338
Protein kinases [BR:nfu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107391338
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase APH Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 107391338
NCBI-ProteinID: XP_015824096
Position
sgr15
AA seq 364 aa AA seqDB search
MQSPVRDSPVRPGYHRLEIQKTTWDVPERYTTLRAIGSGAYGTVCSALDQRTKEKVAIKK
LYRPFQSLIHAKRAYRELRLLRHIQHENVICLLDVFTPDATLEKFQTFYMVMPFVYQDLS
HIMKKKRLTDQIIKYLFYQLLKGLKYIHSAGIIHRDLKPGNLAVSENCDLKILDFGLARQ
TESEMTGYVVTRWYRAPEIIFNWMHYSQTVDVWSSACILAEMITGHVLFPGHDSIDQLTK
ILNLTGTPDPSLVKKMQSKDAQTYVAGLPPQKKKNFKEVFPLMDRSALNLLEGMLLLDPE
KRLTAKQGLSHPYLVEYHEPESEPDSEHYDDSFESLDLDINEWKSLIHMEIMTFDPKNPG
KTAM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccccggtgagagattctcccgtcagaccgggctaccacagactggagatccag
aagacgacgtgggacgtcccggagagatacacgacgctccgggccatcggctccggagct
tacgggactgtgtgctctgccttggaccagaggaccaaagagaaggtggccatcaagaag
ctgtaccgtccgttccagtccctgatccacgccaaacgggcttacagggagctcaggctg
ctccgccacatacagcatgaaaacgtgatctgcctcctcgatgtcttcacgccggacgcc
acgctggagaaattccaaaccttttatatggttatgcccttcgtataccaggacctgagc
catattatgaagaaaaagagactaactgatcaaatcatcaaatacctcttttatcagctt
ctaaagggtctgaagtacatccactctgcagggatcattcatcgagatctgaagcctggt
aacctcgctgtgagtgagaactgcgatttaaagattctggattttggcctggcaagacag
acagagagtgagatgactggttatgttgtgacacgctggtacagagcacctgagatcata
ttcaactggatgcactacagtcagacagtggatgtctggtcatccgcctgcattctggct
gagatgatcacgggccatgtgcttttcccgggacacgacagcattgatcagctgaccaag
atcctcaacctaacaggaactcctgacccgtcgctagtgaagaagatgcagagcaaagat
gcacaaacctatgtggcaggtctccctccacagaaaaagaaaaacttcaaagaggtgttt
cctttaatggatcggagcgctctgaaccttcttgagggaatgctgctgctggatccagag
aagagactgacggctaagcagggactctcccacccctatctggttgaatatcatgaacct
gaatctgaaccagactctgagcattacgacgactcctttgagagtctagatctcgacatt
aacgaatggaaaagtctcattcacatggagatcatgacctttgaccccaagaatcctggc
aagacagccatgtag

DBGET integrated database retrieval system