KEGG   Nothobranchius furzeri (turquoise killifish): 107393634
Entry
107393634         CDS       T05163                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nfu01002]
    107393634 (adamts13)
Enzymes [BR:nfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     107393634 (adamts13)
Peptidases and inhibitors [BR:nfu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   107393634 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_spondin TSP1_CCN Reprolysin_3 Reprolysin_5 Reprolysin_4 Reprolysin_2 ADAM_spacer1 Peptidase_M10
Other DBs
NCBI-GeneID: 107393634
NCBI-ProteinID: XP_015827622
Position
sgr18
AA seq 1389 aa
MIFMTLSCLVLLLPGVSALMGYQQVEKLNNLSIGSGNTVLSSGYSADQSVSERLRRSTLP
DVTHLELMVVVGPDVQQVHKQDTEKYILTNLNIASELLRDTTLGANMRVHLVRMVILSEP
EPEIQMSSNITSSLRSVCDWGRRINPSNDTDPLHADLLLYVTRFDLELLDGNKQVRGVTQ
LGGVCSSEWSCVITEDTGFDLGITIAHELGHSFGINHDGVGNICSRSGFMMASDGGYNSV
DLTWSPCSRQQLFMFFREGRAECVKDLPELRGSLQDWKPGLYYGVDDQCRIAFGSTARAC
SFTSPDLPACRILSCHVEPDDDRSCKRLLVPLLDGTECAPNQWCLKGQCVSPDDIGSSVV
VNGSWSSWSEFSSCSRTCGGGVTLRARQCNNPRPAFGGNDCDGSDIEAELCHQQPCEDTQ
QDFMAEQCSQTDSIPLYLQPKMASFYKWIPALGFVKGDEQCKYMCLSDGESFMVSRGSHF
VDGTRCESDSRSAFGTTAACLQGRCQLFGCDGVLHSGKVWDVCGVCDGDGSTCSLTSDSY
RGGQAKEYTTFLTLPVNATQVHIINKAPLFTHLAVLVGGQYIVSGAGSIAVNVTHPSVLD
ENHLEYRLYLTPDFLPEMEEVIVPGPLKQEIDMQIYRKYGKEYGDKTNPNISYEFYVPAR
NSNVTDDTMRGAWAVHTTSCSVSCGSGVQKNVHVCVDKGNKIHLQQHHCKDPPPNTPLHT
ICHLTACPPRWDAGSFGACSASCGGGVRLRLVRCVQKQGSELVIVQDSECSSDAAPHSAE
KCNMQHCPARWSVSEPGNCSAVCGPGEAKRVVSCVRQEDGQEVEVDQTFCLKQIKPLDLV
LCVIDVCPIGWESKREELPIQRADMTPRSRQARVFVWSPVVSQCSKTCGNGTLQVWFSCV
DHQTRLGVPDFNCDASTKPDPHTEICVSSPCPPMWRSKQGVCSVTCGGGVATRVLYCAVE
VEGEEVVLGDSNCSDFPKPTAVVACNTHSCPAKWRVVRTSPCSASCDLGITQRNVSCLQF
IHGKETMVSEHNCRSAVKPATTAPCLVQVCTYRWEVKPWSQCSAPCGYGIQSRAVSCMGP
SKPEPLSPLFCMNMPKPITIQGCYRASCTNAAFNSTAPKTKVNLAESPLPSAVVIYKDKP
QNRAGNALASPTEAITTQQTTTPTPTPSVCGQLFLEESGTVDLQGVNRRCTVSIGRPLDE
IIHVKILSSSLDCKKKEYVAFFDRLAFVRKCAQVADSQLTSRTNVLLVRQNVFTPGNGVV
FTYSSQKNMKRSLHYDCDIQLFAPRGIFENPVRLNSNHTCRVLINAPPSVKIRIQALHIG
LVFNATNSQSTYIMIRDMDVLKTNVFNGPQLFQWHSSGNMAEIEFHGDYLHTKGTFRAQY
SFVHLGSKR
NT seq 4170 nt   +upstreamnt  +downstreamnt
atgatttttatgactctgtcctgtctggtgctcctgctgcctggcgtcagcgctctaatg
ggatatcaacaggttgagaagcttaataacctctccatcggttcaggaaatactgttttg
tcttcaggatattctgctgaccagtcagtgagcgaacgtctgcgtcgctcaactctgcct
gatgtaacacatctggagctgatggtggtcgtaggacctgatgtccagcaggttcacaag
caggatacagagaaatacattctcactaatctcaacattgcctcagagctgctgagagac
acgactctgggtgccaacatgagggtgcacctggttcgaatggttatcctttcagagcca
gagccagagatccaaatgtcctccaacatcacatcttctctgagaagtgtgtgcgactgg
ggcagaaggattaacccctctaacgacacagatccgctgcatgctgatctcttgttgtat
gttacaaggtttgacctggagctgcttgatgggaacaagcaggtcaggggagtgacgcag
ctgggtggggtttgttccagcgagtggagctgtgtgattactgaggacacagggttcgat
ctgggcatcaccatcgctcatgaacttggtcacagttttggaatcaaccacgacggcgtt
ggaaacatctgcagccggagcggcttcatgatggcgtctgatggaggctacaacagcgtg
gatctgacctggtctccctgcagcaggcagcagcttttcatgttcttcagagaagggaga
gcagagtgtgtgaaggacttgcctgaactcagaggttccctacaagactggaagcccggc
ctgtattacggtgttgatgaccagtgtcgtatagcttttggcagcactgcaagagcatgc
tcgttcacaagtcctgacctgccggcttgtcgtatcctgtcctgccatgttgaacctgat
gacgacagatcctgcaagcgcctcctggttcctctgctggatggcacagaatgtgctcct
aaccagtggtgtctaaagggacagtgtgtgtctccagatgatattggctcctcagttgtt
gtcaatggctcctggtccagctggtccgagttttcctcatgctcacggacttgtggtggg
ggagtgacactccgtgcacgacaatgcaataacccgagacctgcttttggaggcaatgac
tgtgatggttcagacattgaggctgaactttgccaccagcagccttgtgaggacactcag
caggacttcatggcagagcagtgttcccaaacagactccatccctctctacctgcaacca
aaaatggcctctttctacaaatggatccctgctctcggctttgtgaaaggggatgagcag
tgcaaatacatgtgcctgtcagatggagaaagcttcatggtgagtcgtggctctcacttt
gtggatggaacacgttgtgagtcagacagcaggtctgcttttggaacaacagccgcttgt
ctacagggcagatgccagctgtttggctgtgatggtgtgctgcattctggaaaagtgtgg
gatgtgtgcggagtgtgtgatggagatgggtcaacctgcagtttgacatctgactcctac
agaggtggtcaggctaaagagtacaccacttttctgactctgccagtgaatgccacacag
gttcacatcatcaacaaggcaccgctatttactcatttggctgtgctggttgggggtcag
tacattgtgtcgggagcaggcagcatagccgtaaatgtcacccatccatccgtgttggat
gagaaccatctggagtaccgcctctacctgacccctgactttttacctgagatggaggaa
gtgattgtgcccggtccactgaaacaggagatagacatgcagatctatcgcaaatatgga
aaggaatatggtgacaaaacaaatccgaacatcagctatgagttttatgttcctgccaga
aatagtaatgtgactgatgacaccatgcgaggtgcatgggctgttcacacaacatcttgt
tctgtttcctgtggatcaggtgtgcagaagaatgtgcatgtctgtgttgacaaaggaaat
aaaatacatttgcagcagcaccactgtaaagatcctcctccaaacacccccctccacaca
atctgtcacctaacagcatgtccccccaggtgggatgcaggaagttttggcgcttgcagt
gcctcctgtggagggggagtgaggctccgtcttgtccgatgtgttcaaaaacaaggatct
gagttggtgattgttcaagactctgaatgttcctctgacgctgctccacactctgctgaa
aagtgtaatatgcaacactgtcctgccaggtggtctgtgtctgagccaggaaactgttct
gcagtgtgcggaccaggagaagcaaaacgtgttgtgtcatgtgttcggcaagaggatgga
caagaggttgaagtggatcaaactttttgtttgaagcagatcaaaccacttgatcttgtg
ctctgtgtcatagatgtttgccccattgggtgggaatctaagagggaggagctgcccatc
caaagggctgacatgacaccacgctccagacaggctcgtgtgtttgtgtggagtcctgtt
gtcagtcagtgttcaaagacctgtggaaatggaaccctgcaggtgtggttctcttgtgtg
gatcaccagaccagactgggggttcctgacttcaactgtgatgcttctaccaaacctgat
cctcacactgagatctgtgtctcatccccctgtcctcctatgtggcgctctaagcaagga
gtctgcagtgtaacgtgtggaggaggtgtagccactagggtgctgtactgtgctgtagaa
gtagagggagaggaggtggtgctgggtgactccaactgcagtgactttcctaagcccaca
gcagtggttgcttgtaatactcatagctgtcctgcaaaatggagggtagtcaggacgtca
ccttgttctgcatcctgtgatctggggatcactcaaagaaacgtgtcctgtcttcagttt
atccacggcaaagaaaccatggtgtcggagcataactgccgctcagcggtcaaaccggcc
actacagcaccctgcctggtgcaggtctgcacctacaggtgggaggtgaagccatggagc
cagtgttcagccccctgtggatatggtatccagtccagagctgtctcctgcatgggcccc
tccaagccggagcccctcagccccttgttctgtatgaatatgcctaaaccaatcaccatc
cagggctgctacagggccagctgcacaaatgcggccttcaactccactgctccaaaaaca
aaagttaaccttgcagagtcacctctcccatctgcagttgtgatctataaagataaacca
cagaaccgtgcgggcaatgctctagcaagtccaactgaggccataaccactcaacaaacc
accacgcccaccccgacacccagtgtttgtggacagctcttcttggaggaatcaggcaca
gtggatctgcaaggtgtaaacagaagatgcaccgtatccataggtcgacccctggatgag
atcatccatgtgaaaatcctgtctagctccttggactgcaagaaaaaggagtacgtggct
ttttttgaccgtctggcttttgtgaggaagtgtgcgcaggtggcagatagtcaacttacc
agcagaaccaacgttctgcttgtgcggcaaaatgtgttcactcctgggaatggagttgtg
tttacctacagctcacagaagaacatgaagaggagcctccattatgattgtgatattcag
ctatttgcccccaggggcatttttgagaatccggtaaggctgaactccaaccacacctgc
cgggtactcatcaacgcccctccctcagtgaaaatcagaatccaagcactgcacatagga
ttagtattcaatgccaccaattcccagtctacatatataatgatccgggacatggatgtc
ctgaagaccaacgtgtttaacggtccacagctgttccagtggcactcctctggaaatatg
gctgagattgaatttcatggtgactacctgcataccaaagggacattcagagctcaatat
tcctttgtgcatcttggatccaagagatga

DBGET integrated database retrieval system