KEGG   Nothobranchius furzeri (turquoise killifish): 107394221
Entry
107394221         CDS       T05163                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00230  Purine metabolism
nfu00240  Pyrimidine metabolism
nfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107394221
   00240 Pyrimidine metabolism
    107394221
Enzymes [BR:nfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     107394221
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin
Other DBs
NCBI-GeneID: 107394221
NCBI-ProteinID: XP_015828562
UniProt: A0A1A7ZRI2
Position
sgr18
AA seq 296 aa
MSALRRVALFPQVRFLLTCGKINSFRLSGKTSLLTDRTEIPASCLRFMSGSTRVKRVSIE
GNIAVGKSTFARLLQSSCSDWEVVAEPVSKWQNVENNASKSTDSPPQTTVSNLLQMMYQD
PQRWSYTFQTYSCMSRLRTQLQLPSAHLLGSEAAPVQVYERSIYSDRYIFALNMFELGCI
NATEWAIYQDWHSFLVEQFGHRVELQGIIYLRSSPQKCMERLRRRGRHEENEVKLDYLDK
LHVQHERWLVEKSTEIHFDKLKKVPVLLLDAGVEFQSDPEVQEQFITKVKNFLDAL
NT seq 891 nt   +upstreamnt  +downstreamnt
atgtctgctcttcgtcgagtcgctttgtttcctcaggtcaggtttttactcacatgcgga
aagattaacagcttccgtcttagtgggaagacttctctgctgacagacagaacagagatt
ccagcttcctgcttgaggttcatgtcgggctcaactagagtgaagagggtttctattgaa
ggaaacattgctgttggaaagtcgacctttgctagactcttacagtctagttgttcagac
tgggaagtggtggcagaaccagtcagcaagtggcagaatgttgagaataacgcctccaag
agcacagattcacctcctcagacaacagtcagtaacctgctgcagatgatgtaccaggac
cctcagcgctggtcctacacgtttcaaacatattcttgtatgagccggctgagaactcaa
ctgcagcttccttcagctcacctgctcggctcagaggcagcacctgtccaggtgtatgag
cgctcaatctacagtgacagatacatctttgctcttaatatgtttgagctgggttgcatc
aatgcgacggagtgggccatctaccaggactggcactcctttctggtggagcagtttgga
cacagagtggagctacaaggcatcatttacctcagatcgtctcctcagaaatgcatggag
cgcctgaggcgtcgaggaaggcatgaggaaaacgaagtgaagctggactacctggacaag
ctgcatgttcagcatgagaggtggctggtggagaaaagcacagagatacattttgacaaa
ttgaaaaaagtaccagttttactactcgatgccggagtggagtttcagagtgacccagaa
gtccaggagcagtttatcacaaaggtgaagaacttccttgatgctttgtga

DBGET integrated database retrieval system