KEGG   Nothobranchius furzeri (turquoise killifish): 107394321
Entry
107394321         CDS       T05163                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nfu01002]
    107394321
Enzymes [BR:nfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107394321
Peptidases and inhibitors [BR:nfu01002]
 Metallo peptidases
  Family M1
   107394321
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 107394321
NCBI-ProteinID: XP_015828708
Position
sgr18
AA seq 938 aa
MFGLLLVLCVLLPPSPGAQIPNQGQPKHPPIATNGERFPWDQMRLPQTISPLHYDLTIHP
NLTTQDFTGVVRISLDVHEDTSAVILHAKQMEISNVLLLAPEGARPLKVLEYPGFHQLAL
ISDSVLTKGRKYEVQLEFAANLSDSFHGFYKSSYRTSSGEVRTLASTQFEATFARGAFPC
FDEPAFKANFTVQIIREPRHIAVSNMPKVKTVVLPGDLLEDHFDTTVKMSTYLVAYIVSD
FLSVSRTTQHGVKISIYAVPEKINQTAFALDAAVKLLDFYDDYFDIPYPLPKQDLAAIPD
FQSGAMENWGLTTYRETGLLFDPDKSSASDKLSITKVIAHELAHQWFGNLVTMEWWNDLW
LNEGFAKFMEFISLDITYPELHVDDFFLNKCFEAMEVDSLSSSHPVSTPVENPTQIQEMF
DDVSYDKGACILNMLRDFLTPEAFEIGIIRYLKRYSYQNTVNSHLWESLTDLCSLDDLDE
GRMKHFEFCSRRKLQSGTSKWYSDDELDVRAIMDTWTLQEGFPLVTVEVKGREVRLSQER
FLRTDDHSLTEGFLWQIPLTYMTSASNTIHRFLLKTKSDVLYLPEEVEWVKFNVNMSGYY
MVHYAGDGWNSIIKLLQHNHKALSGNDRASLIQNVFQLVSVGKVSLDTALELSLYLSNET
EIMAVTRGFGELVPLYKLMEKRDMTVLEKQMKGYIVELFRDLIDQQQWSDSGSVSERVLR
SYLLLFACFMNYEPCVRKAIQLFSQWKESDGTVSLPVDVSMAVFVIGARTPEGWDFLFEK
YRNSLQMSLKSRYKSAMAISPLQDKLQWMMEQSLHGEVMKTQDLPDVVVSVAKNPRGYKL
AWDFLRASWVTLVKKFDLGSNALSYMVTGVTNQYSTREMLQEIRSFFDSLTEETGSQMRC
IQQTYETIEDNIRWTDTNLPLLQSWLNKRSRRATHEDL
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgtttggcctcctgttggttctctgtgttctcctccctccctcacctggagctcagatc
ccaaaccaaggccaacccaagcacccccccatagccactaatggtgagcgcttcccttgg
gaccaaatgagactcccccaaaccatcagccccctgcactacgacctgaccatccacccg
aacctcaccacccaggacttcaccggtgtggtccggatcagcctggatgtccacgaagac
accagcgctgtgatcctccacgccaagcagatggagatatccaatgtgcttctcctggcc
cctgaaggcgccaggcccctgaaggtgttggagtatcctggtttccatcagctggctctg
atatcagactctgtgctgaccaaaggcaggaagtacgaggtccagctggagtttgctgcc
aacctgtcggacagctttcacggtttttacaaaagcagctaccgcaccagcagtggggag
gtccggactctggcgtccacccagtttgaggcaacgttcgctcgaggagccttcccctgt
tttgatgagcccgcctttaaagccaacttcaccgtacagattatacgagagccgcgccac
atcgccgtttccaacatgcctaaggttaaaacggttgtgctgcccggtgatctgctcgag
gatcactttgacacgactgtaaaaatgagcacgtacctggtggcctacatcgtgtccgac
ttcctgtctgtgagccggaccacgcagcacggcgtcaagatttccatttacgccgttcca
gagaagatcaaccagaccgcctttgctctggatgctgcagtcaagttgttggacttctat
gacgattattttgacattccctaccctcttcccaaacaggacctggcagctattcctgat
ttccagtccggtgcgatggagaactggggcctgaccacctacagagagaccggcctcctc
tttgaccccgataagtcctccgcctccgacaagctgtccatcaccaaggttatcgctcat
gagctcgcacaccagtggttcggaaacctggtgacgatggagtggtggaacgacttgtgg
ctgaacgagggttttgccaagttcatggagtttatttccctggacatcacctacccagag
ctgcacgtggacgacttcttcttgaacaaatgttttgaggctatggaggtggattccctt
agctcctcccacccggtctccacccctgtagaaaaccccacacagatccaggagatgttt
gatgacgtgtcgtatgacaagggagcgtgcattctgaacatgctacgagacttcctcacc
ccggaggcgtttgagatcggcatcatccgatatctaaagcgctacagctaccagaacacc
gtgaacagccacctgtgggagagtctgacggatctctgcagcttggacgatttggacgaa
ggccgaatgaaacactttgaattctgctccagacgtaaacttcagtcaggaacctcgaag
tggtactctgatgacgagctggatgtcagggccatcatggacacctggactctgcaggag
ggcttcccactggttactgtggaggtgaaaggtcgggaggttcgactctctcaggagcgt
ttcctgaggacagatgaccactccctcactgaaggattcttgtggcagattccactaacg
tacatgaccagcgcctccaacaccatccaccgtttcctcctcaaaaccaagagcgatgtc
ctgtacctgccagaggaggtggagtgggtgaagttcaacgttaacatgagcggttactac
atggtccactatgcaggcgacggctggaactccattatcaagctgttgcagcacaaccac
aaggctctgtctgggaacgaccgagccagtctgatccagaacgtcttccagctggtcagt
gttgggaaggtgagcctggacacggccctggagctgtctctgtacctgtccaacgagacc
gagatcatggctgtgactcggggctttggagagcttgttcctctctacaagctgatggaa
aagagagacatgacggtgctggagaagcagatgaaaggttacatcgtagagctgttccgg
gatctgatcgatcagcagcagtggagcgactctggttctgtctccgagcgtgttctgagg
agttacctgctgctgtttgcctgcttcatgaactacgaaccctgtgtgaggaaagccatc
cagctcttcagccagtggaaggagtctgacggcaccgtgagcctccctgtcgatgtctca
atggctgtgtttgtgatcggagctcgcacaccagaggggtgggacttcctgtttgagaag
taccgcaactcgctgcagatgtcgctgaagagccgctataaaagcgccatggctatcagc
ccgctgcaggacaaactccagtggatgatggagcaaagtctccacggtgaggtgatgaag
actcaggacctcccagacgtggttgtgtccgttgccaaaaaccctcgcggctacaagctg
gcctgggacttcctccgagccagttgggtcaccctggtgaagaagtttgacctcggctcc
aacgccttatcctacatggtgactggggtgaccaaccagtactccaccagagagatgctt
caggagattcgaagtttcttcgactcgctgaccgaggagacgggatcacagatgaggtgc
atccagcagacctacgagaccatcgaggataacatccgctggacggacacaaaccttcct
ctgctgcagtcctggctgaacaaacgcagccgcagggcaactcacgaggatttataa

DBGET integrated database retrieval system