KEGG   Nothobranchius furzeri (turquoise killifish): 107394397Help
Entry
107394397         CDS       T05163                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit-like
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu04010  MAPK signaling pathway
nfu04260  Cardiac muscle contraction
nfu04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107394397
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107394397
   04261 Adrenergic signaling in cardiomyocytes
    107394397
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nfu04040]
    107394397
Ion channels [BR:nfu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107394397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin
Motif
Other DBs
NCBI-GeneID: 107394397
NCBI-ProteinID: XP_015828809
Position
sgr19
AA seq 203 aa AA seqDB search
MNRPREPEQFFHYRYGWSFAFAASSFLLKESAGVMSVYLFMKRYAEEELYRPHPALYRPR
MSDCSDYSGQFLHPDSWAPPPRGRSASDVSSDISIQLNQTPPPQQPCKGGSSSQATPSSS
GPSSAASYQLQPASSSSTSSSYPHPLHPGATSTLPRLAHVHGLSQPHPHPSGPPSHSLPM
AGPPSAVPPPRYHAHTRMSASPC
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgacccagagagcccgagcagttcttccactaccgctacggctggtccttcgcc
tttgcagcctcctccttccttctcaaagagagtgcaggagtcatgtccgtctacctcttc
atgaagcgttacgctgaggaggagctttatcgcccacatcctgctctctaccgccctcgc
atgtccgactgcagcgactacagcggccagtttcttcacccagactcctgggctccaccc
ccgcggggccgaagtgcctctgatgtctcgtctgacatctctatccagctcaaccagact
cccccacctcagcagccttgtaaggggggcagcagctcacaagcgacaccctcttcatct
gggccttcatcagctgccagctaccagctccagccagcatcttcctcctccacctcctcc
tcctaccctcacccccttcatccaggcgccacctccaccttacccagactggctcacgtc
catggtctctcacagccccatccccatccaagcggacccccatcccattccctcccaatg
gcaggaccaccctccgctgtgcctcctcctcgctaccacgcacacacacgaatgagtgcc
tcgccatgctag

DBGET integrated database retrieval system