KEGG   Nothobranchius furzeri (turquoise killifish): 107395169Help
Entry
107395169         CDS       T05163                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
nfu  Nothobranchius furzeri (turquoise killifish)
Pathway
nfu00071  Fatty acid degradation
nfu01212  Fatty acid metabolism
nfu03320  PPAR signaling pathway
nfu04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:nfu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107395169
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107395169
   03320 PPAR signaling pathway
    107395169
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nfu03029]
    107395169
Enzymes [BR:nfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     107395169
Mitochondrial biogenesis [BR:nfu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    107395169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 107395169
NCBI-ProteinID: XP_015829964
UniProt: A0A1A8A3X9
Position
Unknown
AA seq 783 aa AA seqDB search
MAEAHQAVAFQFTITPEGIDLQLSYQALNQIYLSGVRSWKKRVSRMKNRVIKGVYPASPS
SWLFVAIAILATMYMQSDPSMGLISKIQQHLPLSLHMSLSAQGQTMLSALVFSTLLWLSL
ILTLRLCLKLLLSYHRWMFELHGKVSNTTKVWVSLLRLFSRRKPLLYSYQTSLPHLPVPA
IKDTLSRYLESVRPLLTDQELKRMTDLANDFESTLGNRLQRYLKLKALWATNYVSDWWEE
YIYLRGRGPIMVNSNYYGMDFLYVTPTTVQAARAGNTITALLLYRRKVNKEELTPSRVPG
TDIPLCAAQCERMFNTTRTPGAETDVLQHWLDSDFVVVYHRGRYFRLWVYRGGRLLSPRE
LEHQIQSILDDPSPPFPGEEKLGALTAGDRCPWAQMRKQFFSSGVNRRSLDAIERAAFFV
TLDDEEQGMKGDDPAGNLDRYAKSLLHGKCYDRWFDKSFSIVIYKNGKNGLNAEHSWADA
PTVAHLWEYTLATDAFHLGYTQDGHCKGEVERSLPPPQRLAWDIPPELQAQVCRSLAVAQ
ALAADVDCHVFPFREFGKGRIKKCRVSPDAFIQISLQLAHYRDRGGFCLTYEASMTRLFR
EGRTETVRSCSSESCTFVKALEGRETEEDCRRLFRRAAEKHQNLYRMAMTGAGIDRHLFC
LYVVSKYLGVDSPFLREVLSEPWRLSTSQTPIQQMELFDLKNHPDFVSLGGGFGPVADDG
YGVSYIIVGEDMINFHVSSKYSCSETDSRRFGVQLRKALQDIMALLSGDPKGSSKGSAQV
QPK
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcccaccaggctgtggcgttccagttcaccataacgccagaaggcattgac
ctccagctgtcctaccaggccctgaaccagatctacctctccggagtgagatcctggaag
aaacgagtcagccgcatgaagaaccgggtgattaagggggtgtacccagccagcccttcc
tcctggctcttcgttgccatagcgatcctggccaccatgtacatgcagtccgatcccagc
atggggctcatttccaagatccagcagcaccttccactaagcctccacatgtctctgagc
gcccagggtcagaccatgctgtccgccctggtcttcagcaccctgctgtggctctccctc
atcctcaccctcaggctctgcctcaagctgctgctctcctaccatcgctggatgtttgag
cttcacgggaaagtctccaacaccaccaaagtgtgggtgagcctgctgcggttattctcg
aggaggaagcctttgctgtacagctatcagacatctctccctcaccttcctgttcctgcc
atcaaagacacgctgagcagatacctggagtctgttcggccgctgctgaccgaccaggag
ctcaaacggatgaccgatctggccaacgactttgagtccaccctggggaaccggctgcag
cgctacctgaagcttaaagcgctgtgggccaccaactatgtgagcgactggtgggaggag
tacatctacctcagaggccggggcccaataatggtcaacagtaattactacggcatggac
tttctgtatgtgacgccaaccacagtccaggctgcgagggccggtaacaccatcactgct
ctgctgctctaccgccgtaaggtcaacaaggaggagctgacgccgagtcgtgttccgggt
acagacatccccctgtgtgctgctcagtgtgagaggatgttcaacacaacacgcactcca
ggggcagagactgacgtcctgcagcactggctggacagcgattttgtggtggtctaccac
agggggcgttatttccgcctttgggtttaccgcggaggtcggctgctttctccaagagag
ctggagcaccagatccagagtatcctggatgacccttcacctccattccctggggaggaa
aaactgggcgctctcactgccggagacaggtgcccttgggctcagatgcggaagcagttc
ttcagctctggggtcaacaggaggtcactggatgccatagagagggcagccttcttcgtg
accttggacgacgaggagcaaggaatgaaaggagacgacccggctggaaacctggaccgc
tacgccaagtctctgctccatggaaagtgttatgataggtggtttgataaatccttttcc
atcgtgatctacaaaaacgggaagaacggtctcaacgcagagcactcatgggccgacgct
ccgacagtggctcacctttgggagtacaccttggccacagacgccttccatctgggctac
acacaagatggacactgtaaaggcgaggtcgagcgctcgctgcccccacctcagaggctt
gcctgggacatccctccagagcttcaggctcaagtctgccgctccctggctgttgcccag
gcactagcagcagacgtggactgccacgtgtttcctttcagagagtttggaaagggtcgg
atcaagaagtgccgcgtcagccctgacgccttcatacagatcagcttacagctggcgcac
tacagggaccgtggtggtttctgtttgacgtacgaggcatccatgactcgtttgttcagg
gagggacgaacagagacggttagatcctgctcaagcgagagctgcaccttcgtcaaggct
ctggagggcagggagacggaggaggactgccgtcgcctgttccgccgggccgctgagaaa
caccagaacctgtatcgaatggccatgacgggagctgggatagacagacacctcttctgc
ctctatgtggtctccaaatacctgggagtggactcgcctttcctcagagaggtcttgtct
gagccctggcgcctctccaccagtcagactcccatccagcagatggagctgttcgacctg
aagaaccacccggatttcgtctcacttggtggaggatttggacctgttgcagatgacggt
tacggggtgtcatacatcattgttggtgaggacatgataaacttccatgtgtcgtccaag
tactcctgcagtgagactgactcccgcaggtttggagtccagttacgaaaagctcttcag
gacatcatggctttgctctcaggtgacccgaaaggctcatcgaagggctcggcccaggtg
cagcccaagtag

DBGET integrated database retrieval system