KEGG   Candidatus Nitrososphaera gargensis: Ngar_c04840Help
Entry
Ngar_c04840       CDS       T02305                                 

Gene name
adh2
Definition
(GenBank) NAD-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
nga00010  Glycolysis / Gluconeogenesis
nga00071  Fatty acid degradation
nga00350  Tyrosine metabolism
nga00625  Chloroalkane and chloroalkene degradation
nga00626  Naphthalene degradation
nga01100  Metabolic pathways
nga01110  Biosynthesis of secondary metabolites
nga01120  Microbial metabolism in diverse environments
nga01130  Biosynthesis of antibiotics
nga01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ngar_c04840 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    Ngar_c04840 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ngar_c04840 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ngar_c04840 (adh2)
   00626 Naphthalene degradation
    Ngar_c04840 (adh2)
Enzymes [BR:nga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ngar_c04840 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C AlaDh_PNT_C ELFV_dehydrog DAP_epimerase
Motif
Other DBs
NCBI-ProteinID: AFU57428
UniProt: K0IF44
Position
complement(358090..359130)
Genome map
AA seq 346 aa AA seqDB search
MAEKMRAMVLTKLAPIETRPLKLMSIDRPVAKGRNELMIEIEACGVCRSNLHLIEGDWKR
FGAPSHLPVVPGHEVVGVVKQVGSGVKKIKVGDRVGIQPLFSSCLQCEYCTTGKENLCES
AEITGETVQGGYAEYISALEEFVTPIPDNLDSEHAAPLFCPGITAYKAVKASEPAAGRTV
GIFGIGGVGHLAIQIAKMQGARVIAMSRAKKHLDLSKKLGADNVIVYQDSQGQFLKNLKK
EEGGLLDSAIVFAPSDKVIDTAIKSVKKGGTIVLGVLGNVSDFPTFEEKIVKGSVIGTMK
DMAELVSLASSSGLKVVIETHKLEEANEVLARLKKSQVEARAVLVP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaaatgcgggcaatggtcctgacaaagcttgccccaatagaaacccggccg
ctgaaattgatgtcgattgacagacccgtggcaaagggcagaaacgaactgatgatagag
atagaggcgtgcggcgtctgccggtcaaacctgcaccttatagaaggcgattggaaaagg
tttggcgcgccttcgcacctgccagtggttcccggccacgaagtggtgggcgtggtcaag
caggttggcagtggcgtgaaaaagatcaaggtaggcgacagggtaggaatccagccgctt
ttcagctcttgtcttcagtgcgaatactgcactaccggcaaagagaacctttgtgagagc
gccgagataacaggagagacagtacagggtggctacgccgagtacatttctgcgctagaa
gagtttgtcacgccgatcccggacaatctggactcagagcatgccgctccgctattttgc
cccggcataacagcgtacaaggcagtcaaggcaagcgagccggcggcaggcagaacagtc
ggcatttttggcatcggaggcgtcggccacctagcaatacagatagccaagatgcagggt
gcaagggtaatagcaatgtcaagggcgaaaaagcatcttgatctgtcaaaaaagctgggc
gcagacaatgtcattgtctaccaagattcgcaggggcagtttctgaaaaacctgaaaaag
gaggaaggagggctccttgacagcgcaatagtctttgcgccctctgacaaagtgatagat
accgccatcaagtctgtcaaaaagggtggcaccatcgtgctgggcgtgcttggcaatgtc
tctgattttccgacgtttgaagaaaagatagtgaaagggagcgtcatcggcacaatgaag
gacatggccgagctggtcagtttggcaagcagttccggcctgaaagtggttattgagact
cacaagctggaagaagctaatgaagtattggcaaggctcaaaaagtcgcaggtagaggcc
cgcgcagttctggttccctag

DBGET integrated database retrieval system