KEGG   Candidatus Nitrososphaera gargensis: Ngar_c07560Help
Entry
Ngar_c07560       CDS       T02305                                 

Definition
(GenBank) nicotinamide-nucleotide adenylyltransferase
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
nga00760  Nicotinate and nicotinamide metabolism
nga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Ngar_c07560
Enzymes [BR:nga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     Ngar_c07560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AFU57699
UniProt: K0IMA6
Position
complement(581318..581845)
Genome map
AA seq 175 aa AA seqDB search
MSTTGLFVGRFQPFHKGHLATVKFALGKVDLLVIVVGSAQKSHEPRNPFTAGERIRMVKE
SLDSEKEVDADRILIIPVPDVDVHSLWTRHVDMLVPKYDVVFANDPFTLMLFRERGIKTI
EAPLVDRSEMRATEIRNRMITGSKWEGLVPAPVARIIKEINGVERVKAIAERSHH
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgaccacagggctcttcgtcggccggttccagcccttccacaaggggcaccttgcg
actgtcaagttcgcccttggcaaggtggatctattggtaattgtggtcggcagcgctcaa
aagagccacgagcccagaaacccgttcacagccggcgagcgcatcaggatggtaaaggag
tcgctagactctgaaaaagaagttgatgctgacaggatactgataataccggtccctgat
gtcgacgtgcattcgctttggacccggcatgtggacatgttggtcccgaaatatgatgtt
gtgtttgccaacgaccctttcaccctcatgctgttccgggagagaggcatcaagaccatc
gaagcgccgctcgtcgacaggagcgagatgcgggctaccgagatccggaacaggatgatc
acgggcagcaagtgggagggtcttgtgcccgccccggtagcaagaataatcaaagagatc
aacggcgtcgaaagggttaaggcaatcgccgaaaggagccaccattga

DBGET integrated database retrieval system