KEGG   Candidatus Nitrososphaera gargensis: Ngar_c11500Help
Entry
Ngar_c11500       CDS       T02305                                 

Definition
(GenBank) putative digeranylgeranylglycerophospholipid reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
nga00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ngar_c11500
Enzymes [BR:nga01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     Ngar_c11500
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     Ngar_c11500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_oxidored DAO FAD_binding_2 FAD_binding_3 NAD_binding_8 HI0933_like Lycopene_cycl Trp_halogenase Pyr_redox_2 GIDA Thi4 AlaDh_PNT_C Pyr_redox_3 Pyr_redox 3HCDH_N NAD_binding_7 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AFU58091
UniProt: K0I9T7
Position
895115..896320
Genome map
AA seq 401 aa AA seqDB search
MEEERYDIAVVGGGPAGLSAAYSAARAGAKVVLFEKDEAIAHSVRTSGVTWISEMERLGI
PARYYNPVQNYRFVSPLNDVMISGSTPKSCVLDVRGTYQHLAFMAAEAGAKIMVKSNIIN
VLKQDNNKIAGVKASTPKGDLTVRSTLVIDASGFSASVARRAGASGEWKRYGVGAEYECY
CDDIDSATWVLMVGRRYSDAGYAWIFPLSRNRVRIGVGIGRPESSAEPLEKLHDILEKRH
RPLDTFGKIQPVELHYGFIPNEGVRQNSIADGLVMVGDSAGQSNPLVLEGIRYAIEFGRL
AGEVGAKSLPRGASRESLMDYEKAWKAKVESKIQSALRVQTRWLGLTDEEWDKEIEILRD
MTVDEFLDFIKADFTAGKMMKLALHHPKLAARQLFNMILKS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaaagatacgacattgcagtcgtcgggggcgggccggcaggtctttctgcc
gcatattccgcagcacgggccggcgcaaaggtagtcttgtttgaaaaggacgaagccatt
gctcacagcgtcagaacaagcggcgtcacttggatttcggaaatggagaggctcggcata
cctgctcgatactacaaccctgtacagaactaccgctttgtgtcgcctttaaacgacgtc
atgatttccggaagcacccctaagtcgtgcgtccttgatgtaagggggacataccagcac
ttggcgtttatggcggccgaggccggcgccaagatcatggtgaaaagcaacatcatcaac
gtgctcaaacaggataataacaagatcgccggcgtcaaggcaagcacccccaagggcgat
ctgactgtgcggtcaacgcttgtcatagacgcaagcggcttctccgcctctgtcgcgcgc
agagctggcgcctcaggcgaatggaagcgctacggggtcggagccgagtacgaatgctac
tgcgacgacattgacagcgcgacgtgggtccttatggtcggccggcgctattcggacgcc
ggctatgcttggatattcccgctgtcgaggaacagggtcaggataggagtagggattggc
aggccagaatcgagcgcagaaccgcttgaaaaactgcacgacattttggaaaaaaggcac
aggccacttgacacttttggaaagatacagccggtggagctccactatgggttcatacca
aacgagggggtcaggcagaatagcatcgcagatggccttgtgatggtgggcgactcggca
ggccagtcaaacccgctagtgcttgagggcatacgctatgcaatcgaatttggaaggctg
gccggggaggtgggggcaaagtcgcttccgcgtggtgccagcagggaatctttgatggac
tatgaaaaagcatggaaggcaaaggtcgaatccaagatccagtcggccctgagggtacag
acgcgttggctcggcctgactgacgaagaatgggataaagagatagaaattctccgggac
atgacagtcgacgagtttctggactttatcaaggccgactttacggcaggcaagatgatg
aagcttgcgctgcaccacccaaagctggcagcgcgacaattgtttaacatgatcttgaag
agctaa

DBGET integrated database retrieval system