KEGG   Candidatus Nitrososphaera gargensis: Ngar_c16620Help
Entry
Ngar_c16620       CDS       T02305                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
nga00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nga01100  Metabolic pathways
nga01110  Biosynthesis of secondary metabolites
nga01130  Biosynthesis of antibiotics
nga01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ngar_c16620 (trpC)
Enzymes [BR:nga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ngar_c16620 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE His_biosynth AP_endonuc_2 Cellulase
Motif
Other DBs
NCBI-ProteinID: AFU58595
UniProt: K0IFK7
Position
1293346..1294155
Genome map
AA seq 269 aa AA seqDB search
MMSKFVRTGLGIKRLVDNSFKAIDEGAYDTTAYSLTHDAISLRKAITLCLHAPLISEVKF
SSPSQGRIRSKTTSSLVEIATTMIKSGAIGLSVLTQPYLFEGSIEYLTAIRKAVSAPLLM
KDIIVSTIQIDAGKKAGADCILLIKTIFDQDLAEESMEKLAEYATNKGLQVLVEVHTEQE
FGEVLNAKYPLIGINNRNLDNLQVDIATTERLLKNHDKGKSLIISESGIAKPADIQYLRK
AGADAFLVGTSIMETGDIGAKVAELYNAL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcaagtttgtcaggaccggcttggggataaagcgcctcgtagacaattcattc
aaggccatagacgagggcgcgtacgatacgacggcgtattcgctcacgcacgatgcgata
agcctcagaaaggcgatcactttgtgcctccacgccccgctcatcagtgaggtaaagttc
tcctcgccttcgcagggcaggataaggagcaagactacttcttcgctggtagagatcgca
accactatgataaagtcgggcgcaatcggcctgtcagtcctgacacagccctatcttttt
gaaggctcgattgaatatctgacggctatcagaaaggcagtcagcgcgccactgctcatg
aaggatatcatcgtcagcaccatccagatcgacgcgggcaaaaaggccggtgcagattgc
atattgcttatcaagaccatctttgatcaggatttggcggaagaaagcatggaaaagctg
gccgagtatgcgacaaataagggcctgcaggtgctagtcgaagtccacaccgagcaggag
tttggcgaagtgctcaatgcaaagtatccattgattggcatcaacaaccgcaaccttgac
aacctgcaagtggacattgcaaccaccgagcgcctgctcaaaaaccacgacaagggtaag
agcctgataataagcgagagcggcattgccaagccagcagacatacagtacctgaggaag
gctggcgcagacgcttttttggtcgggacgagcataatggagacaggcgacatcggggcc
aaggtggccgagctgtacaacgctctttaa

DBGET integrated database retrieval system