KEGG   Candidatus Nitrososphaera gargensis: Ngar_c16640Help
Entry
Ngar_c16640       CDS       T02305                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
nga00260  Glycine, serine and threonine metabolism
nga00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nga01100  Metabolic pathways
nga01110  Biosynthesis of secondary metabolites
nga01130  Biosynthesis of antibiotics
nga01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ngar_c16640 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ngar_c16640 (trpA)
Enzymes [BR:nga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ngar_c16640 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG NanE IMPDH Ribul_P_3_epim PcrB DHO_dh IGPS
Motif
Other DBs
NCBI-ProteinID: AFU58597
UniProt: K0IJZ2
Position
1295418..1296239
Genome map
AA seq 273 aa AA seqDB search
MPNRITEKFGELAGRDKCALICYVVAGYPDIKTSEQVIDALVKGGADIIEIGIPFSDPIA
DGPTIQAASNSALKRGITPEKALQLAKSVRKKHPELPLLAMTYSNILVHAGMEKFMSRAK
SCGIDGFILPDMPVEEAESYSAAASKLGLATVFLASPNTSEVRLKKIVDSTSGFLYLVSV
FGITGARKSFEDYTLNAVKSVKQAASGRVPVAVGFGISTPAHAKFMIEAGADAVIVGSAI
IDMIAKSSGKKMLAGLQEFARSMKKACKKSRTR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatagaatcaccgaaaaattcggcgagctggcaggcagggacaaatgcgcgctc
atatgctatgtcgtcgccggctaccctgacatcaagacctcggagcaggtgatcgatgct
ctggtaaaaggcggtgccgacattatcgagattggaatcccgttttcagatcctatcgct
gacggacccacgatacaggccgcgtcgaacagcgcgctcaagcgcggcatcacaccggaa
aaggcactacagcttgcaaaaagcgtaaggaaaaagcaccctgagctgccgctgcttgca
atgacttattctaacatacttgtccacgccggcatggagaaattcatgtcgcgggccaag
tcgtgcggtatcgacggatttatcctgcctgacatgcctgtggaggaggcagaatcatac
tctgcagcagcatcaaagctcggccttgcaaccgtattccttgcttcgcccaacacgtct
gaagtgcggctcaaaaaaatagttgacagcacttctggatttctgtacttggtctctgtc
tttggcataactggggcccgcaagtcgtttgaagactatacactgaacgcagtcaagagt
gtcaagcaggccgccagcggcagagtgcctgtggcggtggggttcggcataagcacaccg
gcgcacgccaagttcatgatagaggccggcgccgatgcagtcattgtaggcagcgcaatc
atagacatgatagccaagtcgtctggcaaaaagatgctagcagggctgcaggaatttgcc
agatcgatgaaaaaggcctgcaaaaaaagtaggacaagataa

DBGET integrated database retrieval system