KEGG   Candidatus Nitrososphaera gargensis: Ngar_c17620Help
Entry
Ngar_c17620       CDS       T02305                                 

Gene name
thrC1
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
nga00260  Glycine, serine and threonine metabolism
nga00750  Vitamin B6 metabolism
nga01100  Metabolic pathways
nga01110  Biosynthesis of secondary metabolites
nga01120  Microbial metabolism in diverse environments
nga01230  Biosynthesis of amino acids
Module
nga_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nga00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ngar_c17620 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ngar_c17620 (thrC1)
Enzymes [BR:nga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ngar_c17620 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFU58695
UniProt: K0IFX9
Position
1369518..1370858
Genome map
AA seq 446 aa AA seqDB search
MDAYAIKKCINPACGLTYEINNDIYRCSCGSLLDIKYNKKPSRDLVETFYQRRNHGGNIY
NESGVWRFRDLINFAGIDTENFEECARVLVSLDGSEGRLSKPYNMSKAADYAEMNHDSFL
LQPEGYNPSGSFKDNGMSTAVTHAKMLGVKRIICASTGNTSASAAMYAANENMECDVYIP
KGEIAPGKLGQAFQFGAQVIQVQGNFDDALAASLKNAKETGGYTVNSVNPFRLEGQKTIV
YRVLEHLNWNPPDWIVYPGGALGNTSSCGKCLIELYEWGWIKKIPRMAIVNAEGANTFYE
LYNGLFEGKRLTWNDGRPDLAMVDRYYEHLDKKGIRPKTHATAIQIGKPANIVKALRALD
FTNGIVVQVSDKEMSDGMSIVGLNGFDCEMASGAVPAGVRKLRREGLIKRDDVVVGILTG
RQKDPGLAVEYHTNPNNMFAKPPTSH
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctacgcaatcaaaaagtgtatcaatccagcgtgcggtcttacttatgaaatt
aacaacgacatctaccggtgctcctgcggctcgctccttgatataaaatacaacaaaaag
ccaagccgcgatcttgtcgaaacgttctaccagcgacgcaaccacgggggcaacatttac
aacgaaagcggtgtatggcgcttccgcgaccttatcaattttgccggcattgacactgaa
aactttgaagaatgcgcacgtgttttggtctcccttgacggctctgaaggccgcctctca
aagccctacaacatgagcaaagcggctgactatgcagaaatgaaccatgattcgttcctg
ctccagcccgaaggctacaacccatccggctcgttcaaggacaatggcatgtcgaccgcg
gtgacccatgcaaagatgcttggagtaaaaaggataatctgcgcttccaccggcaatact
tcggcctctgctgcaatgtatgctgccaacgaaaacatggagtgcgatgtctatattcca
aagggcgaaattgcgcccggcaagcttggacaggcgttccagtttggcgcgcaagtgata
caggttcagggcaactttgacgacgctcttgcggcgtcgctcaaaaatgccaaagaaacc
ggcggatatactgttaattccgtaaacccattccgccttgaaggacaaaagactattgtc
tatcgggtcctagaacacctcaactggaacccgcctgattggatcgtatatcccggaggg
gcgcttggcaacacttcaagctgcggcaagtgcctgattgaactgtacgaatggggttgg
atcaaaaaaatcccgcgcatggcaatagtgaacgcagaaggcgcaaacacattctacgaa
ctctataatggcttgttcgaaggcaagcggctgacctggaacgacggtaggccggatctt
gcaatggttgatcgctactacgagcatttggacaagaaaggcatcaggccaaagacccat
gcaacggctatccagataggaaaacctgccaacattgtaaaagcactgcgcgcgctcgat
tttacaaatggcatcgttgtgcaagtaagcgacaaggaaatgagcgacggtatgtcgata
gtcgggctcaacggctttgactgtgaaatggcgtctggagctgtgccagccggcgtgaga
aagctacgcagagagggcttgataaaacgcgatgatgtggtggttggcatacttactgga
agacagaaggatccggggcttgcagtagaatatcataccaatccaaataacatgtttgca
aagccgccaacaagccactag

DBGET integrated database retrieval system