KEGG   Candidatus Nitrososphaera gargensis: Ngar_c18160Help
Entry
Ngar_c18160       CDS       T02305                                 

Definition
(GenBank) putative tetrahydromethanopterin S-methyltransferase, subunit A
  KO
K00577  tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
nga00680  Methane metabolism
nga01100  Metabolic pathways
nga01120  Microbial metabolism in diverse environments
nga01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nga00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Ngar_c18160
Enzymes [BR:nga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Ngar_c18160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrA Birna_VP3 Pro_CA T3SS_needle_reg
Motif
Other DBs
NCBI-ProteinID: AFU58749
UniProt: K0IN48
Position
complement(1412507..1412980)
Genome map
AA seq 157 aa AA seqDB search
MGIRKKLDDVAGKVCEAVLPIKHEYHLGMGKELAICTLSSMDLLEKLSKSDPVMNKIAIA
GRLLSENRGIDAMIKFALDHPELRRIIVCGKEVKGHRAGQALLALARNGIDRNGRIVGAL
GPYPILESPAGDVDAFRQQVEILDMIGTTDIEKLLVA
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgggcatccggaaaaaactcgacgatgtggccggtaaggtgtgtgaagccgtgctgccg
atcaagcacgaataccaccttggcatgggaaaggagctggcgatatgcactctgtcaagc
atggatctcttggaaaagctatccaagtctgatcctgttatgaacaagatcgcaatagcc
ggccggctcctctcggagaacaggggcatcgacgcgatgatcaagtttgcgctcgatcat
ccagagcttaggcgcataatcgtctgcggcaaagaggtcaaggggcacagggcgggtcag
gccctgcttgcgcttgccagaaacggcatagacaggaatggcaggatagtcggcgcactg
gggccgtacccgatattagagtcgccagccggcgatgtggatgcattcaggcaacaggtc
gaaatcttggacatgataggcaccactgatattgagaagctactagtagcctga

DBGET integrated database retrieval system