KEGG   Candidatus Nitrososphaera gargensis: Ngar_c33660Help
Entry
Ngar_c33660       CDS       T02305                                 

Definition
(GenBank) putative pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
nga  Candidatus Nitrososphaera gargensis
Pathway
nga00790  Folate biosynthesis
nga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ngar_c33660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nga04147]
    Ngar_c33660
Enzymes [BR:nga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Ngar_c33660
Exosome [BR:nga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ngar_c33660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a EHD_N
Motif
Other DBs
NCBI-ProteinID: AFU60281
UniProt: K0IFV9
Position
2637200..2637535
Genome map
AA seq 111 aa AA seqDB search
MSLGEMKCEPCRGGMPPLTDEEIEQYHRQTRSWSVIEKDGIKRLEKSFKFKDFAQALAFT
NKVGELAEKEGHHPDILTEWGRVTVTWWTHKIKGLHRNDFIMAAKTDALAA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttggtgaaatgaagtgcgagccctgccgtggaggcatgcctccactcaccgac
gaagagatcgagcagtaccaccggcagactcggagctggtcagttatagaaaaggatggg
ataaagcggcttgaaaagtccttcaagttcaaggattttgcgcaggcgcttgcctttaca
aacaaggtaggcgagcttgcagagaaagagggtcaccacccggacatactgacagagtgg
ggaagggtcacggtcacttggtggacccacaagataaaagggctccacaggaacgacttt
atcatggccgccaagacagatgctcttgcagcctaa

DBGET integrated database retrieval system