KEGG   Nannochloropsis gaditana: NGA_0150820Help
Entry
NGA_0150820       CDS       T02917                                 

Gene name
LTAA
Definition
(RefSeq) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ngd  Nannochloropsis gaditana
Pathway
ngd00260  Glycine, serine and threonine metabolism
ngd01100  Metabolic pathways
ngd01110  Biosynthesis of secondary metabolites
ngd01130  Biosynthesis of antibiotics
ngd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ngd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NGA_0150820 (LTAA)
Enzymes [BR:ngd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     NGA_0150820 (LTAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 17361533
NCBI-ProteinID: XP_005854754
UniProt: K8YSJ1
Position
Unknown
AA seq 283 aa AA seqDB search
MGNLISIMIWCSARGSSFICGEKSHVFLCEEGGAAQFGGVSPFPVPHSEADGSLSLESLR
KAIVEESSDASLAQLITLENPVDRCGGRVLSTTYLESVAALAHEHGLKLHLDGSRIWNAA
VAAGVDVKEMTKHADSVTVCMSKGLGAPAGSLLVGSRAFTEKARKLRKALGGAMRQVGVL
AAAGLVALKRTLPRLAEDHENARRLAKGLSTLPGLKVNVEAVETNIVMIDFEDRLPLSPP
ELLEELERRNVLALAVGPRRIRMVTHYDVSEGDIKKAITVFEK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggggaatctgatcagcatcatgatttggtgctctgcccgcggtagctccttcatttgc
ggggagaagagtcacgtcttcctgtgtgaagaaggtggcgctgcacaattcgggggggtg
agcccctttcctgtgcctcatagcgaggcggatgggagtttgagcctggagagcctccgg
aaggccatcgttgaggagtcgagtgatgcaagcctcgctcagctcattacgttggaaaat
ccggtcgaccggtgcgggggccgcgtgttgagcaccacttaccttgagtctgtggctgcc
ctcgcgcacgagcacgggttaaagctccacctggatggctctcgcatctggaacgcggcg
gtggcggcgggggtggacgtgaaggagatgaccaagcacgccgacagtgtcactgtctgc
atgtccaaggggcttggggcacccgccggttcgctcttggtcgggtcgcgcgccttcacc
gagaaggcccgcaagctccggaaggctctgggcggggccatgcgccaggtgggcgtgctg
gcggcggcgggactggtggcgctcaaacggaccttgccgcgcctggcggaggaccacgag
aacgcgaggcgactggccaaagggctctccaccctccccggcctgaaagttaacgtggaa
gcggtcgagaccaacatcgtgatgatagacttcgaggaccggctcccgctgtccccgccc
gagctcctggaggagctagagcggaggaacgtgcttgcacttgcggtgggtccccgacgg
atccggatggtgacccactacgacgtttcggagggggacatcaagaaagccatcacggtc
ttcgagaag

DBGET integrated database retrieval system