KEGG   Nannochloropsis gaditana: NGA_0210200Help
Entry
NGA_0210200       CDS       T02917                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ngd  Nannochloropsis gaditana
Pathway
ngd00480  Glutathione metabolism
ngd00590  Arachidonic acid metabolism
ngd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    NGA_0210200
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NGA_0210200
Enzymes [BR:ngd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NGA_0210200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 17361375
NCBI-ProteinID: XP_005854605
UniProt: K8YVS0
Position
Unknown
AA seq 344 aa AA seqDB search
MRQQLHRPAPRRSSRLLLLLALVLGASYSNAFVSSPLLKKLAPLAHKQRCRMSAPQEEGS
SSTDLHTAQSSLSLNRADLLKRTLRAASSFSLVWLTGQREADAGEEGAPDASVEVAKESA
QPAPVSPPATAPGPLKTAYDYAVPYDGVRVPLGNFRGKAVVVCNAKTDDPESLAQIPGLT
YLTGKYSKKGLKVWVFTTEQGTFETDEDRVIRIKYYQQYGFGQYPNSLVFDKIDIVGKRA
DPFYKFLCKTLRNPNKIARITLNFEKFLLDANGRPVRRYPRRYTAYDMEEDVKAVLAGEP
LPPPSPKLIKAWRDAYVEAERSEYAFKKGLNYYEPLGEDQRSLP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaacagttgcaccgtcctgccccaagacggtcgtcccggcttctccttttgctt
gctttggtactcggggcatcatattccaatgcctttgtctcttctccccttttgaaaaag
ctcgctcctctagcccacaaacagagatgtcgcatgtctgcgccgcaggaagaagggtca
tcaagcacagaccttcacactgcccaatcgtcattgagcctgaatcgtgccgatcttctc
aagcggactttaagggctgcttcctccttctctctggtgtggctcaccggccagcgagag
gcggacgcgggggaggaaggcgctccggacgcctccgtggaggtggctaaggaaagtgca
cagcctgctcccgtctcgcctccagcaactgcccccggcccattgaaaactgcctacgat
tatgccgtaccctacgacggcgtgcgggtgcccctcgggaattttcgggggaaagcggtc
gttgtgtgcaatgccaagaccgacgatccggagagcttggcgcagattccaggcctcacg
tatttgacggggaagtacagcaagaaaggcttgaaggtatgggtgttcaccaccgaacaa
ggcaccttcgaaacggacgaggaccgagtaatccgcatcaagtactatcaacagtacggc
tttggtcaataccctaacagcttggtgttcgacaagattgacattgttggaaagcgcgcc
gatccgttctacaaattcttgtgcaaaacgttgcggaatccgaacaagatcgcccgcatc
actttgaattttgaaaaattcctgttggatgccaacggtcgccccgtccgccgttacccg
cgccgttacactgcctatgacatggaagaagatgtgaaagccgtgctggcgggggagccc
ctgcccccccccagcccgaaactgatcaaagcctggcgcgacgcttatgtcgaagcggaa
cggagcgagtatgcgttcaagaagggtctgaattactacgagccgttgggggaggaccaa
cgcagccttccctga

DBGET integrated database retrieval system