KEGG   Natronobacterium gregoryi: Natgr_0491Help
Entry
Natgr_0491        CDS       T02383                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nge  Natronobacterium gregoryi
Pathway
nge00020  Citrate cycle (TCA cycle)
nge00190  Oxidative phosphorylation
nge00650  Butanoate metabolism
nge00720  Carbon fixation pathways in prokaryotes
nge01100  Metabolic pathways
nge01110  Biosynthesis of secondary metabolites
nge01120  Microbial metabolism in diverse environments
nge01130  Biosynthesis of antibiotics
nge01200  Carbon metabolism
Module
nge_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nge_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nge_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nge00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Natgr_0491
   00650 Butanoate metabolism
    Natgr_0491
  Energy metabolism
   00190 Oxidative phosphorylation
    Natgr_0491
   00720 Carbon fixation pathways in prokaryotes
    Natgr_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF969 Cation_efflux CCB2_CCB4
Motif
Other DBs
NCBI-ProteinID: AFZ71745
UniProt: L0AFA8
Position
492207..492572
Genome map
AA seq 121 aa AA seqDB search
MSERYSTFTPGGTGWLLQRITAAFLVVVLAFHFFQLHFVNHAADVTFAGTQARMENVGYF
LTMVLFLIAGAFHGLNGVYNALVNQGLKGTPKKIVFWVLVIAGVALIVQGTYVALAMAGW
S
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaacgctactccacgttcacgcctggtggaactggatggctcctccagcggatc
acggcggcgtttctcgtcgtcgtgctcgccttccacttcttccagcttcacttcgtcaat
cacgcggccgacgtgacgttcgctggcacgcaggcccgaatggaaaacgttggctacttc
ctgacgatggtgttgttcctgatcgccggcgcattccacggcctgaacggcgtctacaac
gccctagtcaaccagggcctcaaggggaccccaaagaaaatcgtgttctgggtccttgtc
atcgcaggtgtcgcgttgatcgtccaagggacctacgtcgcactcgctatggcgggatgg
agctaa

DBGET integrated database retrieval system