KEGG   Natronobacterium gregoryi: Natgr_1080Help
Entry
Natgr_1080        CDS       T02383                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
nge  Natronobacterium gregoryi
Brite
KEGG Orthology (KO) [BR:nge00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Natgr_1080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF2333
Motif
Other DBs
NCBI-ProteinID: AFZ72310
UniProt: L0AGU2
Position
1064358..1065533
Genome map
AA seq 391 aa AA seqDB search
MVGTLLLIGIVASIFVGFNIGGSSTGIAWGPPVGAGIVKKTTAAALMTFFVFLGGWTVGR
NVMDTLSEGIITIDLTLSAGVAVLFFIGLGILIANIFGVPVPTSMTTVGAIAGLGLATGT
LNYATIAEIVAWWIVTPIIGFWIGGVIGRYIYPEVNRRVQIEKSDGPLLTLERDGKIPKP
TFGPNTTWSEIGSTAVVLVIGCYMAFSAGASNVPNAAAPLVGEAGLEANIAIVIATLAIG
VGGFTIARRTMDSVGGELSDIPLLAALFVMVTASTITTLLSWIGIPISLVMATVMTIVGI
GWGRATRPITVREAVTQDTKESEVVPGAITADEMEGKPAAPIGEEEPEGVLKAGDLFNPR
AVMKYISMWIIGPSVSTLLAYGFFILVPGVV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggtaggaactctcctcctaattgggattgtcgcgtcaatctttgtcgggttcaatatt
ggtggctcatctactgggatcgcgtgggggccaccggttggtgctggtattgtcaaaaag
acgactgcggcagccctcatgacgtttttcgtctttctcggtgggtggactgtcggacgg
aacgtgatggacacgttgagcgaagggatcatcacgattgatctcacgctctccgcaggt
gtcgccgtcctctttttcattggactgggcattctcatcgccaatatcttcggggttcct
gttccaacgtcaatgacaaccgttggagcgatagctggcctcggtctggcgacaggcaca
ctcaactacgcgacaattgccgagatcgtcgcttggtggatcgtaacaccaatcattggg
ttctggattggcggtgttattggacgatacatctatccggaagtcaaccgacgagtacag
attgaaaaatcagatggtccattgctaactcttgaacgagacggaaaaattccgaagccc
acgttcggcccaaacacgacgtggtctgaaatcggtagcacggcagttgtcctcgtcatt
ggttgttacatggcatttagtgccggggcgagtaacgtgccgaacgccgctgcaccgctg
gtgggcgaagcagggttggaagcgaatatagcgattgtcatcgccacgcttgctatcgga
gtcggtgggttcaccatcgcccgccggacgatggactctgtcgggggcgaactgagtgac
atcccgctactcgcagcgctgttcgtcatggttacggcatcgacaatcacaacgcttctc
tcgtggattgggattccaatcagcctcgtgatggcaacggtgatgacgattgtcggcatt
gggtggggtcgcgcaactcgaccgattaccgtccgtgaggccgttactcaggacacgaaa
gagagcgaggttgtccccggtgcgatcaccgccgacgagatggaaggcaaaccagccgca
ccgattggtgaagaagaaccggaaggggtactcaaagcgggtgacctcttcaatccacgt
gccgtgatgaaatatatctcgatgtggattatcggtccctcggtctcgacacttctggcc
tacggattcttcattctcgttccgggagtcgtctga

DBGET integrated database retrieval system