KEGG   Natronobacterium gregoryi: Natgr_2182Help
Entry
Natgr_2182        CDS       T02383                                 

Definition
(GenBank) methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
nge  Natronobacterium gregoryi
Pathway
nge00630  Glyoxylate and dicarboxylate metabolism
nge00660  C5-Branched dibasic acid metabolism
nge01100  Metabolic pathways
nge01120  Microbial metabolism in diverse environments
nge01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Natgr_2182
   00660 C5-Branched dibasic acid metabolism
    Natgr_2182
Enzymes [BR:nge01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     Natgr_2182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C ASL_C2
Motif
Other DBs
NCBI-ProteinID: AFZ73360
UniProt: L0AJX2
Position
complement(2132804..2134045)
Genome map
AA seq 413 aa AA seqDB search
MTTIEDVSATPGMTAFFADDQAAIAAGAEPDGFAYAGEPETPGFDRIREPGEAVLVELAL
GDGRVVRGDCAAVQYAGVGERDPVFRADDHVELVEGDLRDALVGRPADSLEQNAAVLEEL
DCHSAVEYGVSQALVAAAAAAAETTRTRVLAEALDTEPATEPLPVFGQSGSDRRRGAEKM
LLKRVDVLPHGLFNSLETVGPDGRRLVEYLSWLADRTTELGDHEYDPRFHVDVYGMLGEL
FEPPYDRSAVIEYVDDLRQAAAPYSLQLEEPVLADSREAQIAAMRSLRDGLAAADVPVDL
VADEWCDRREDVEAFVDAGAADVVQVKSPDVGSLLESGRAVRYCQDTDVRAYLGGTCNET
TTSARATVHVGLATDAAQLLAKPGMGFDEGYAIVTNEMRRTLARHRRTQPNRL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatcgaagacgtgtcggcgacgcccggcatgacggcgtttttcgccgacgac
caggctgccatcgctgccggcgcggaaccggacgggttcgcgtacgccggagagccggaa
acccctgggttcgaccgcattcgagaacccggcgaggcagtcctcgtcgaactcgcgctc
ggcgatggacgcgtcgtccgaggggattgtgcggcggtccagtacgcaggcgtcggtgaa
cgggacccggtgttccgggccgacgaccacgtcgagctcgtcgaaggcgacctgcgagac
gcactcgtcgggcgaccggccgactccctcgagcagaacgccgccgtcctcgaagaactg
gactgtcactccgccgtcgagtacggcgtctcgcaggcactcgtcgctgccgcggctgcg
gccgcagagacgacacgaactcgcgtcctcgccgaggctctcgacaccgagccggcgacc
gagccgctcccggtgttcggacagtccggctcggaccgccgacgtggcgctgaaaagatg
ttgctcaagcgcgtggacgtactcccacacggcctgttcaacagcctcgagacggtcggg
ccggacggccgtcgactcgtcgagtacctctcgtggctcgccgaccgcacgaccgaactc
ggcgaccacgagtacgacccacggtttcacgtcgacgtgtacggaatgctcggggagctg
ttcgagccgccgtacgaccgttctgccgttatcgagtacgtcgacgacctgcggcaggcg
gccgctccctactccctccagctcgaggaaccggttctcgccgacagccgggaggcacag
atcgcggccatgcgatcgctccgggacgggctcgcggctgccgacgttcctgtcgacctg
gttgcagacgagtggtgtgaccgccgtgaagacgtcgaggcattcgtcgacgccggcgca
gcagatgtcgtacaggtaaagtcgccggatgtcggctccctcctcgagagcggtcgtgcc
gtcagatactgccaggacaccgacgtgcgagcgtatctcggcggtacctgtaacgagacg
actacgtcggcgcgtgcgaccgtccacgttggcctggcaaccgacgctgcacaactcctc
gcaaagcccggcatggggttcgacgaggggtatgccatcgtcaccaacgagatgcgtcgg
acgctcgcccgacaccgacgaacgcagccgaaccgtctgtag

DBGET integrated database retrieval system