KEGG   Natronobacterium gregoryi: Natgr_2446Help
Entry
Natgr_2446        CDS       T02383                                 

Definition
(GenBank) folate-binding protein YgfZ
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
nge  Natronobacterium gregoryi
Pathway
nge00260  Glycine, serine and threonine metabolism
nge00630  Glyoxylate and dicarboxylate metabolism
nge00670  One carbon pool by folate
nge01100  Metabolic pathways
nge01110  Biosynthesis of secondary metabolites
nge01130  Biosynthesis of antibiotics
nge01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Natgr_2446
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Natgr_2446
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Natgr_2446
Enzymes [BR:nge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Natgr_2446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AFZ73612
UniProt: L0AKD4
Position
complement(2386038..2387147)
Genome map
AA seq 369 aa AA seqDB search
MSVIESIHEDHGATFGERGGRTIVEHFGRPERTHRAVRNGVGLLEIVYGVVVVEGDDRLE
YVDNVVSNRVPSEDGRGCYALVLEPQGAVEVELYVYNAGERLLLFVPPEKAEPLAEEWSE
KVFIQDVDIRVATDEYGIFGIHGPQATEKIASVLNGAASPDQRLSFVRGSMGDSGVTVAR
TDALTGEESYEVICAAADADAVYDVLLNQGLNAAPFGYRVFESLTLEAGSPRFESELAGT
VPNVLGLRNALDFEKGCYVGQEVVSRVENQGRPSRRLTGLTLSSGVDDGEPRVPDPGAAV
FDGDASVGEVTRAGKSPLLEETIALALVDYDLESGDLTVRVGGEEVPASRTELPFYEGSD
RSARLPDYE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcatcgagtcgatccacgaggaccacggggccacgttcggtgaacggggcggg
cggacgatcgtcgaacacttcggccgtccagagcggactcaccgcgcggtccgcaacggc
gtcggcctgctcgagattgtctacggagtcgtcgtcgtggaaggcgacgaccgcctcgag
tacgtcgacaacgtcgtctcgaatcgcgtccccagcgaggacggtcggggctgttacgcg
ctcgtcctcgagccccagggcgcagtcgaggtcgaactgtacgtctacaacgccggtgag
cggttactgctgttcgttccgcccgagaaagcggaaccgctggccgaagagtggtcggag
aaggtattcattcaggacgtcgacatccgcgtcgcaacagacgagtacgggatcttcggc
atccacggaccgcaggcgaccgaaaagatcgcgagcgtcctcaacggcgcggcttcgccc
gaccagcgactctcgttcgtccggggttcgatgggcgactcaggtgtcaccgtcgcccgt
accgacgcgctgaccggcgaggagagctacgaggtgatctgtgccgccgccgacgcagac
gccgtctacgacgtgctcttgaaccagggactgaacgctgcccccttcggctaccgggtc
ttcgagagtctcacgctcgaggctggctcgccgcgtttcgagagtgaactcgcggggacg
gtcccgaacgtactcggccttcgaaacgccttagacttcgagaagggctgttatgtcggc
caggaagtcgtctcccgcgtcgaaaatcagggacggccgagccgtcggctcaccggactg
acgctctccagtggcgttgacgacggcgagccacgggttccggaccccggtgcagccgtc
ttcgacggcgacgcctccgtcggagaggtcactcgagcgggaaagagcccactactcgag
gagacgatcgcgctcgcgctcgtcgactacgacctcgagagtggcgacctgacggttcgc
gtcggtggtgaggaggtgccagcgagtcggaccgaactgccgttctacgagggatcggat
cggtcggcgcggttgccggactacgagtga

DBGET integrated database retrieval system