KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_CH10740Help
Entry
RG540_CH10740     CDS       T03244                                 

Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Pathway
ngg00230  Purine metabolism
ngg00240  Pyrimidine metabolism
ngg01100  Metabolic pathways
ngg01110  Biosynthesis of secondary metabolites
ngg01130  Biosynthesis of antibiotics
Module
ngg_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ngg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ngg_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:ngg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RG540_CH10740
   00240 Pyrimidine metabolism
    RG540_CH10740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngg04131]
    RG540_CH10740
Enzymes [BR:ngg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     RG540_CH10740
Membrane trafficking [BR:ngg04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    RG540_CH10740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: CDN47262
UniProt: A0A068SLX7
Position
1034723..1035145
Genome map
AA seq 140 aa AA seqDB search
MAIERTFSMIKPDATKRNLTGAITKVFEDNGLRVIASKRVWMSKREAEGFYAVHKERPFF
GELVEGMTSGPTIVQVLEGENAILKNREIMGATNPANADEGTIRKTFALSIGENSVHGSD
APETAAQEIAYWFSETEIVG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgaacgcacgttttcgatgatcaagccggatgccaccaagcgcaacctcact
ggcgccatcaccaaggtgtttgaagacaatggcctgcgcgtcatcgcttccaagcgcgtg
tggatgagcaagcgcgaagccgaaggcttctacgccgttcacaaggaacgcccgttcttc
ggcgaactggtcgaaggcatgacctccggcccgaccatcgttcaggttctggaaggcgaa
aacgccatcctcaagaaccgcgagatcatgggcgccaccaacccggccaacgctgacgaa
ggcaccatccgcaagaccttcgcgctgtcgatcggcgagaactcggttcacggttccgac
gctccggaaaccgccgcccaggaaatcgcctactggttctccgaaaccgagattgtcggc
tga

DBGET integrated database retrieval system