KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_CH13100Help
Entry
RG540_CH13100     CDS       T03244                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Pathway
ngg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ngg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RG540_CH13100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ngg03011]
    RG540_CH13100
Ribosome [BR:ngg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RG540_CH13100
  Bacteria
    RG540_CH13100
  Archaea
    RG540_CH13100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 TniB
Motif
Other DBs
NCBI-ProteinID: CDN47490
UniProt: A0A068SR01
Position
1269423..1269812
Genome map
AA seq 129 aa AA seqDB search
MAKAKTERRLKDNEAQAVARTLRVSPQKLNLVAAMIRGKKVERALAELEFSRKRIAGTVK
KTLESAIANAENNHDLDVDALIVSEAYVGKSIVMKRFHARGRGRASRIEKPFSHLTIVVR
EVEEKGEAA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggctaagaccgaacgccggctgaaggataacgaggcgcaggcagttgcgcgt
acgctccgcgtcagcccccagaagctgaacctcgttgccgccatgatccgcggcaagaag
gtagaacgcgcgcttgcagaactcgaattctcgcgcaagcgcatcgccggcaccgtgaag
aagaccctcgagtctgcaatcgccaatgccgaaaacaaccatgacctcgacgtcgacgcg
ttgatcgtatcggaagcctatgtaggcaagtcgatcgtgatgaagcgcttccacgctcgc
ggccgcggccgtgcatcgcggatcgagaagcctttctcgcatctgacgatcgtcgtccgc
gaagtcgaggaaaaaggggaggctgcataa

DBGET integrated database retrieval system