KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_CH22780Help
Entry
RG540_CH22780     CDS       T03244                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Pathway
ngg00071  Fatty acid degradation
ngg00072  Synthesis and degradation of ketone bodies
ngg00280  Valine, leucine and isoleucine degradation
ngg00310  Lysine degradation
ngg00362  Benzoate degradation
ngg00380  Tryptophan metabolism
ngg00620  Pyruvate metabolism
ngg00630  Glyoxylate and dicarboxylate metabolism
ngg00640  Propanoate metabolism
ngg00650  Butanoate metabolism
ngg00900  Terpenoid backbone biosynthesis
ngg01100  Metabolic pathways
ngg01110  Biosynthesis of secondary metabolites
ngg01120  Microbial metabolism in diverse environments
ngg01130  Biosynthesis of antibiotics
ngg01200  Carbon metabolism
ngg01212  Fatty acid metabolism
ngg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ngg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RG540_CH22780
   00630 Glyoxylate and dicarboxylate metabolism
    RG540_CH22780
   00640 Propanoate metabolism
    RG540_CH22780
   00650 Butanoate metabolism
    RG540_CH22780
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RG540_CH22780
   00072 Synthesis and degradation of ketone bodies
    RG540_CH22780
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RG540_CH22780
   00310 Lysine degradation
    RG540_CH22780
   00380 Tryptophan metabolism
    RG540_CH22780
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RG540_CH22780
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RG540_CH22780
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RG540_CH22780
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ngg04147]
    RG540_CH22780
Enzymes [BR:ngg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RG540_CH22780
Exosome [BR:ngg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RG540_CH22780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CDN48446
UniProt: A0A068SRR6
Position
complement(2267090..2268268)
Genome map
AA seq 392 aa AA seqDB search
MSEVVIVQPVRTAIGKYNGSLAGIPAVDLGAAVIRETIARSGLDAAEVASVTMGNVVQAG
NKMNPARQAAIHGGLPVSVPAVTVNRVCGSGVEAIASAAKDIWLDHAKAAIAGGMENMDR
APYLMSGGRWGYRMGHAEIFDSMLLDGLHDAFSDRHSGWHTEDMIASQQISRADQDRWAA
RSQQRFSAAQAEGRFAAEIVGIDLPVKGSVKSFAVDETPRPDTTIEALAKLKPAFRDDGT
ITAGNAPGLNSGAAAMIVADRAFAEAKGLRPMARLVSYGVAAVEPGMFALGPIPAVNQAL
ERAGWAIGDIERIEINEAYAAVPLAVLKGLGLPEDIANVEGGAVAHGHPIGATGAILTTR
LLHSMQRDGLKRGVVTLCIGGGQGIALALEMI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagtcgtcatcgtccagccggtccgcaccgcgatcggcaaatataacggttct
ctcgccggcatcccggcggtcgatctcggcgccgcggtgatccgtgagacgatcgcgcga
tccggccttgatgccgccgaggtggcctcggtcaccatgggcaatgtcgttcaggcagga
aacaaaatgaacccagcgcggcaggcggcgatccatggcggcctgccggtctcggtgccg
gccgtcacggtcaaccgcgtctgcggttccggtgtcgaggcgatcgccagtgcggccaag
gatatctggctcgatcatgccaaggcggccatcgccggcggcatggagaacatggaccgc
gcgccctacctgatgagtggcggccgctgggggtatcgcatgggccatgcggaaatcttc
gacagcatgctgctcgacgggctgcacgatgcgttttcggacagacattccggctggcac
acggaggacatgattgcctcgcagcagatcagccgcgcggatcaggatcgctgggcggca
cgttcgcagcagcgtttcagcgccgctcaggccgagggcaggttcgctgccgagatcgtc
ggcatcgaccttccggtgaagggcagcgtgaagagttttgccgtcgatgaaaccccaagg
ccggataccacgatagaggcgcttgccaaactgaagccagccttccgcgacgacggcacg
atcaccgccggcaatgcacccggcctcaacagcggtgcggcggcgatgatcgtcgcggat
cgggcctttgccgaagccaagggcctgcgcccgatggcgcggctggtatcctatggcgtc
gccgcggtcgaacccggcatgttcgcgcttgggccgatcccggccgtcaaccaggcgctg
gagcgtgccggctgggcgatcggcgatatcgagcggatcgagatcaacgaggcctatgcg
gcggtaccgcttgcggtcctgaaagggctcggcctgccggaggatatcgccaatgtcgaa
ggcggcgcggtggcgcacggtcatccgatcggcgccaccggcgccatcctgacgacgcgg
cttctgcattcgatgcagcgcgacggcctgaagcgcggtgtggtgacgctctgcatcggc
ggcggccagggcattgcgctggcgctggaaatgatctga

DBGET integrated database retrieval system