KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_CH23030Help
Entry
RG540_CH23030     CDS       T03244                                 

Definition
(GenBank) Maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Pathway
ngg00350  Tyrosine metabolism
ngg00643  Styrene degradation
ngg01100  Metabolic pathways
ngg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ngg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    RG540_CH23030
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    RG540_CH23030
Enzymes [BR:ngg01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     RG540_CH23030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C
Motif
Other DBs
NCBI-ProteinID: CDN48471
UniProt: A0A068SRT9
Position
complement(2298026..2298670)
Genome map
AA seq 214 aa AA seqDB search
MSDTVLYDYWRSSASYRLRIALNMVAETFRTVPVDILAKEHRSQEHLARNPQGLVPVLEI
DGHSFTQSLAVIEYLDETRGGAFLPGDSVGRQRVRALSYVIAMEIHPVCNSHVGAHVMSI
TGGGEEARVAWMRKFIGEGLAAFEVLLDSPSTGAFCHGDRPSMADICLVPQVYNARRWGV
DLSACPRLVAIADRCVELKPFAKAHPDQVKPSGS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacacggttctctacgattactggcggtcctcggcgagctatcgtctgaggatc
gccctcaacatggtcgccgaaacattccgtacggttccggtcgatattctcgccaaggag
cacaggtcgcaggagcatctcgcccgcaatccgcaagggctggtgccggttctagagatc
gacgggcacagtttcacccaatcgctggcggtcatcgaatatctcgacgagacgcgcggc
ggcgccttcctgccgggcgattctgtcggccgacagcgggtgagggcgctctcctacgtt
atcgccatggaaatccaccccgtctgcaattcgcatgtcggcgcccatgtcatgtcgatc
accggcggcggagaagaggcgcgggttgcctggatgcggaagttcatcggcgaggggctg
gcggcgttcgaagtgttgctcgattcaccctcgaccggcgcgttctgtcatggcgaccgg
ccgagcatggcggatatctgtctcgtgccgcaggtctacaacgcgcggcgatggggcgtc
gatctctctgcctgccccaggctcgtcgcgatcgctgaccgctgcgtcgaattgaagccc
ttcgcaaaagcccatccggaccaggttaagccttcaggtagctga

DBGET integrated database retrieval system