KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_PA00250Help
Entry
RG540_PA00250     CDS       T03244                                 

Definition
(GenBank) Tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Pathway
ngg00380  Tryptophan metabolism
ngg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    RG540_PA00250
Enzymes [BR:ngg01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     RG540_PA00250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase YfdX FliS Sec7_N IDO
Motif
Other DBs
NCBI-ProteinID: CDN50704
UniProt: A0A068SXW5
Position
pHAMBI540a:28191..29030
Genome map
AA seq 279 aa AA seqDB search
MSSKPYDPGEDGAEMSFREKMSYSDYLHLEKVLDAQEPISAAHDELLFIIQHQTSELWMK
LAIHEITSAIEAIRNDDPQPAFKMLTRVARIFEQLNNAWDVLRTMTPSEYTEFRASLGQS
SGFQSYQYRAIEFLAGNRNVAMLGPHAHRPDIIEKLEGILAHPSLYDEALMLLSRRGFDI
GEDAARTDWRTKRPENEQVLEAWKQVYSAPGTYWELYELAEKLVDFEDYFRRWRFNHVTT
VERVIGFKRGTGGTSGTSYLKKMLEVELFPELWRVRTVL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgaaaccttacgatcccggcgaagacggcgcggaaatgtcttttcgcgagaag
atgtcctattccgactacctgcatctcgaaaaggtgctcgacgcgcaggagccgatctcg
gcggcgcatgacgaactgctgttcatcatccagcaccagacgtccgaattgtggatgaag
cttgcgatccacgagatcacctcggcgatcgaagccatccgcaacgatgatccgcaaccg
gccttcaagatgctcacccgcgtcgcccggattttcgagcaactcaacaatgcctgggac
gtgttgcgcaccatgacgcccagcgaatatacggaattccgcgcctcgctcggccagtct
tccggcttccagtcctatcagtatcgggcgatcgagttccttgccggcaatcgcaacgtg
gcgatgctcgggccgcatgcgcatcggcccgatatcatcgagaagctggagggcatcctt
gcccacccgagcctttacgacgaggcgctgatgctgctttctcggcgcggcttcgatatc
ggcgaggacgcagcaagaaccgactggcgcacaaaacgacctgagaacgagcaggtgctg
gaggcctggaaacaggtctacagtgcgcccggcacctattgggagctttacgaactcgcc
gaaaagctggtcgacttcgaggactatttccgccgctggcgattcaaccatgttaccacg
gtggaacgggtgatcggcttcaagcgtggcacgggcggcacgtcgggaacgtcgtatctg
aagaagatgctggaggtcgaactgtttcccgaactctggcgggtgcgtaccgttctgtaa

DBGET integrated database retrieval system