KEGG   Neorhizobium galegae bv. orientalis HAMBI 540: RG540_PA16740Help
Entry
RG540_PA16740     CDS       T03244                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase 2
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
ngg  Neorhizobium galegae bv. orientalis HAMBI 540
Brite
KEGG Orthology (KO) [BR:ngg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RG540_PA16740
Enzymes [BR:ngg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     RG540_PA16740
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     RG540_PA16740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA YcaO
Motif
Other DBs
NCBI-ProteinID: CDN52350
UniProt: A0A068T4U6
Position
pHAMBI540a:complement(1785885..1786832)
Genome map
AA seq 315 aa AA seqDB search
MSNIIGITMGDPCGVGPEITVKALAEMSDADRSATRVYGNLATLEAARDAVGVTLDLTPY
VVDLPVEGAPLPWGQLSAVAGDAAFRFIERAVRDAEAGSIGCIVTAPINKEALNLAGHHY
DGHTGMLRSLTGSAAAYMLLASDRLKVIHVSTHVSLQEAIRRATTERVLATIRAGDAHLK
RIGYQRPRIAVAGINPHCGENGLFGTEDDDQIAPAVVAARAEGIEVQGPISADTVFHRAY
SGTFDLVVAQYHDQGHIPIKLVAFDTAVNVSVDLPIDRTSVDHGTAFDIAGKGIANHGNM
NSAIAYARKLVVGVR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatcattggcatcaccatgggagatccctgtggcgttggtccggagataacc
gtcaaggccctcgccgaaatgtccgacgccgatcggtccgcaacgcgggtctatggcaat
cttgcgacgctggaggcggctcgtgatgcggtgggggtcacgctcgatctcacaccttac
gtcgtcgaccttccggtggagggagcgcctttgccctgggggcagctgtcggcggtcgcc
ggcgatgcggcgttccgcttcatcgagcgtgccgtgcgcgatgccgaggccggctcgatc
ggctgcatcgtcaccgcgccgatcaacaaggaagcgctcaaccttgcaggtcatcactat
gatggccatacgggtatgttgcgcagcctcaccggttcggcagcggcatatatgctgctg
gcgtccgaccgcctgaaggtgatccatgtctccacgcatgtctccctgcaggaggccatc
cggcgcgccacgacggaacgggttctggcgacgatccgcgccggtgacgcgcatctgaag
cgcatcggttatcaacgtccgcgcattgcagttgccggcatcaatccccattgcggcgaa
aacggcctcttcggcacagaagatgacgatcagatcgcgccggccgtcgtggccgctcgc
gccgaaggtatcgaggttcaaggcccgatttcagccgatacggttttccaccgcgcctat
tccggcaccttcgatctggtcgtcgcgcagtatcacgatcagggccatatcccgatcaag
ctcgtggccttcgatacggccgtcaacgtttccgtcgatctgccgatcgatcgcacctcc
gtcgatcacggcaccgcgttcgatatcgccggcaaggggatcgccaatcacggcaacatg
aattctgccatcgcctacgcgcgcaagctcgtggtgggggtccgataa

DBGET integrated database retrieval system