KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103724452
Entry
103724452         CDS       T03372                                 

Gene name
Tnf
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi01523  Antifolate resistance
ngi04010  MAPK signaling pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04061  Viral protein interaction with cytokine and cytokine receptor
ngi04064  NF-kappa B signaling pathway
ngi04071  Sphingolipid signaling pathway
ngi04150  mTOR signaling pathway
ngi04210  Apoptosis
ngi04217  Necroptosis
ngi04350  TGF-beta signaling pathway
ngi04380  Osteoclast differentiation
ngi04612  Antigen processing and presentation
ngi04620  Toll-like receptor signaling pathway
ngi04621  NOD-like receptor signaling pathway
ngi04622  RIG-I-like receptor signaling pathway
ngi04625  C-type lectin receptor signaling pathway
ngi04640  Hematopoietic cell lineage
ngi04650  Natural killer cell mediated cytotoxicity
ngi04657  IL-17 signaling pathway
ngi04660  T cell receptor signaling pathway
ngi04664  Fc epsilon RI signaling pathway
ngi04668  TNF signaling pathway
ngi04920  Adipocytokine signaling pathway
ngi04930  Type II diabetes mellitus
ngi04931  Insulin resistance
ngi04932  Non-alcoholic fatty liver disease
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi04940  Type I diabetes mellitus
ngi05010  Alzheimer disease
ngi05014  Amyotrophic lateral sclerosis
ngi05132  Salmonella infection
ngi05133  Pertussis
ngi05134  Legionellosis
ngi05135  Yersinia infection
ngi05140  Leishmaniasis
ngi05142  Chagas disease
ngi05143  African trypanosomiasis
ngi05144  Malaria
ngi05145  Toxoplasmosis
ngi05146  Amoebiasis
ngi05152  Tuberculosis
ngi05160  Hepatitis C
ngi05161  Hepatitis B
ngi05163  Human cytomegalovirus infection
ngi05164  Influenza A
ngi05165  Human papillomavirus infection
ngi05166  Human T-cell leukemia virus 1 infection
ngi05168  Herpes simplex virus 1 infection
ngi05169  Epstein-Barr virus infection
ngi05170  Human immunodeficiency virus 1 infection
ngi05205  Proteoglycans in cancer
ngi05310  Asthma
ngi05321  Inflammatory bowel disease
ngi05322  Systemic lupus erythematosus
ngi05323  Rheumatoid arthritis
ngi05330  Allograft rejection
ngi05332  Graft-versus-host disease
ngi05410  Hypertrophic cardiomyopathy
ngi05414  Dilated cardiomyopathy
ngi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103724452 (Tnf)
   04350 TGF-beta signaling pathway
    103724452 (Tnf)
   04064 NF-kappa B signaling pathway
    103724452 (Tnf)
   04668 TNF signaling pathway
    103724452 (Tnf)
   04071 Sphingolipid signaling pathway
    103724452 (Tnf)
   04150 mTOR signaling pathway
    103724452 (Tnf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103724452 (Tnf)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103724452 (Tnf)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103724452 (Tnf)
   04217 Necroptosis
    103724452 (Tnf)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103724452 (Tnf)
   04620 Toll-like receptor signaling pathway
    103724452 (Tnf)
   04621 NOD-like receptor signaling pathway
    103724452 (Tnf)
   04622 RIG-I-like receptor signaling pathway
    103724452 (Tnf)
   04625 C-type lectin receptor signaling pathway
    103724452 (Tnf)
   04650 Natural killer cell mediated cytotoxicity
    103724452 (Tnf)
   04612 Antigen processing and presentation
    103724452 (Tnf)
   04660 T cell receptor signaling pathway
    103724452 (Tnf)
   04657 IL-17 signaling pathway
    103724452 (Tnf)
   04664 Fc epsilon RI signaling pathway
    103724452 (Tnf)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103724452 (Tnf)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103724452 (Tnf)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103724452 (Tnf)
  09163 Immune disease
   05310 Asthma
    103724452 (Tnf)
   05322 Systemic lupus erythematosus
    103724452 (Tnf)
   05323 Rheumatoid arthritis
    103724452 (Tnf)
   05321 Inflammatory bowel disease
    103724452 (Tnf)
   05330 Allograft rejection
    103724452 (Tnf)
   05332 Graft-versus-host disease
    103724452 (Tnf)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103724452 (Tnf)
   05014 Amyotrophic lateral sclerosis
    103724452 (Tnf)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103724452 (Tnf)
   05410 Hypertrophic cardiomyopathy
    103724452 (Tnf)
   05414 Dilated cardiomyopathy
    103724452 (Tnf)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103724452 (Tnf)
   04940 Type I diabetes mellitus
    103724452 (Tnf)
   04932 Non-alcoholic fatty liver disease
    103724452 (Tnf)
   04931 Insulin resistance
    103724452 (Tnf)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103724452 (Tnf)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103724452 (Tnf)
   05135 Yersinia infection
    103724452 (Tnf)
   05133 Pertussis
    103724452 (Tnf)
   05134 Legionellosis
    103724452 (Tnf)
   05152 Tuberculosis
    103724452 (Tnf)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103724452 (Tnf)
   05170 Human immunodeficiency virus 1 infection
    103724452 (Tnf)
   05164 Influenza A
    103724452 (Tnf)
   05161 Hepatitis B
    103724452 (Tnf)
   05160 Hepatitis C
    103724452 (Tnf)
   05168 Herpes simplex virus 1 infection
    103724452 (Tnf)
   05163 Human cytomegalovirus infection
    103724452 (Tnf)
   05169 Epstein-Barr virus infection
    103724452 (Tnf)
   05165 Human papillomavirus infection
    103724452 (Tnf)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103724452 (Tnf)
   05144 Malaria
    103724452 (Tnf)
   05145 Toxoplasmosis
    103724452 (Tnf)
   05140 Leishmaniasis
    103724452 (Tnf)
   05142 Chagas disease
    103724452 (Tnf)
   05143 African trypanosomiasis
    103724452 (Tnf)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103724452 (Tnf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103724452 (Tnf)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103724452 (Tnf)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Tumor necrosis fators
   103724452 (Tnf)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Haparin
  Cytokines
   103724452 (Tnf)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 103724452
NCBI-ProteinID: XP_008819768
Position
Un
AA seq 313 aa
MRAYPRPPLTPGPIKAAVCSPCQQTLPRQGHQGTYLVGEKQLQTTVEIAPRQASIQPSRF
CSSHTLARGSTSPSGKDTMSTESMIRDVELAEEALPQKAGGPQGSRRCLCLSLFSFLLVA
GATTLFCLLNFGVIGPQREEKFPNNLPIISSMAQTLTLRSPSQNSSDKPVAHVVANQQAE
EQLEWLSQRANALLANGMELRDNQLVVPSDGLYLIYSQVLFKGQGCPNYVLLTHTVSRFA
VSYQHKVNLLSAIKSPCPKETPEGDELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDF
ADSGQVYFGIIAL
NT seq 942 nt   +upstreamnt  +downstreamnt
atgagagcctatccccgccctcctctcaccccagggcctataaaggctgctgtctgctca
ccctgccagcagacgctccctcggcaaggacaccaggggacctacctggtgggagagaag
caactccagaccaccgtggaaatagctcctagacaagcaagcatccagccaagcaggttc
tgttcctctcatacactggctcgaggctccacatcaccctctggaaaggacaccatgagc
acagaaagcatgatccgggacgtggagctggcagaggaggcactcccccaaaaggcgggg
ggcccccagggctccaggcggtgtctgtgtctcagcctcttctccttcctgcttgtggcc
ggagccaccacgctcttctgtcttctgaacttcggtgtgatcggcccccagagggaggag
aagttcccgaataacctgcctatcatcagctccatggcccagaccctcacactcagatca
ccttctcaaaactcaagcgacaagcctgtggcccatgttgtagcaaaccagcaagcggag
gagcagttggagtggctgagccagcgtgccaatgccctcctggccaatggtatggaactc
agagacaaccagctggtggtgccatcagacgggctatacctcatctactcccaggttctc
ttcaagggccaaggctgccccaactatgtgctcctcacccacaccgtcagccgctttgct
gtctcctaccaacacaaagtcaacctcctctctgccatcaagagcccttgccccaaggag
acccctgagggggatgagctcaagccctggtatgagcccatctacctgggaggcgtcttc
cagctagagaagggtgaccaactcagcgccgaggtcaatctgcccaaatatttagacttt
gctgactctgggcaggtctactttgggatcattgctctctga

DBGET integrated database retrieval system