KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103724971
Entry
103724971         CDS       T03372                                 

Gene name
Tm7sf2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00100  Steroid biosynthesis
ngi01100  Metabolic pathways
Module
ngi_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103724971 (Tm7sf2)
Enzymes [BR:ngi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103724971 (Tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 103724971
NCBI-ProteinID: XP_008820376
Position
Un
AA seq 473 aa
MGRGRVHLKTAGRAQRLSELSVQTGAGVAKPSGNGAGRVSLIDFCEPSVPGGTEIMAQLE
GSQAPLEFGGPLGTAAMLVLLPATMFHLLLVARSGPARLLGPPPYLPGLEELWSPRALLL
LFAWLGLQAVLYLLPARKVAEGLELKDKSRLRYPINGFQALVLTTLLMGLGVTAGLPLGA
LPEMFLPLAFATTLTSFIFSLLLYVKALVAPASALAPGGSSGNPVYDFFLGRELNPRIGS
FDFKYFCELRPGLIGWVLINLALLVREAELRGSPSLAMWLVNGFQLLYVGDALWYEEAVL
TTMDITHDGFGFMLAFGDLAWVPFTYSLQAQFLLYHPQPLGWPMALFICLIQAVGYYIFR
GANSQKNTFRKNPSDPSVAGLETIPTATGRQLLVSGWWGMVRHPNYLGDIIMALAWSLPC
GVSHLLPYFYVLYFTVLLVHREARDEQQCLRKYGRAWREYCKRVPYRIMPYVY
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgggcagggggcgcgtccatttaaagaccgctggacgtgcacagcggttgtccgagctc
agcgtccagacaggtgcaggcgtagctaagccatctgggaatggggcgggccgtgtttcc
ttgatcgacttttgtgagccctcggtccccggcggaacggaaatcatggcccaacttgag
ggctcccaggccccgttggaattcgggggacccttgggcaccgcggcgatgctggttctg
ctgcccgccaccatgttccacctgctcctggtggctcgctccggccccgcgcgcctcctg
ggcccaccaccatacctgcccgggctggaggagctgtggagcccacgggcgctgctgcta
ttgttcgcctggctcggcctgcaggcggtgctctacctgctgcctgcccgcaaggtggcc
gaggggctggaactgaaggacaagagtcgcctgcgctaccctattaatggcttccaggcc
ctagtgctgacaaccctgttgatggggctgggggtgacagcggggctgcccctgggggca
ctcccggaaatgttcctgcctttggcctttgcaacaacactcaccagcttcatcttcagc
ctcctcctctatgtgaaggcgctggtagctcctgcctcagcgctggccccagggggaagc
tcaggcaatccggtttacgacttcttcctgggacgggagctcaaccctcgcattggttcc
tttgacttcaaatatttctgtgagctgaggcctggcctcatcggctgggtcctcatcaac
cttgccctcctggttcgggaggcagagcttcgggggagtccctcactggccatgtggctg
gtcaatggcttccagctgctgtatgtgggtgatgctctctggtatgaggaggctgtcctc
accaccatggacatcacacatgatgggtttggcttcatgctggcttttggggacctggcc
tgggtacctttcacctacagcttgcaggcccaatttctgctgtaccatccccagcctctg
gggtggcccatggccttgttcatctgcctcatccaagctgttggttactacatcttccgt
ggtgctaactctcagaaaaacactttccgaaagaatccttctgatcccagtgtggctggt
cttgaaaccatccctactgctacagggcggcagctgctggtgtctgggtggtggggtatg
gttcgtcatcccaactaccttggagatatcatcatggctctggcctggtccttgccctgt
ggggtgtctcacctgctcccctacttctacgtcctctacttcaccgtgctgctggtgcac
cgggaggcccgagacgagcagcagtgcctacgcaagtacggccgggcttggcgcgagtac
tgcaagcgtgtgccttaccgcatcatgccctatgtctactga

DBGET integrated database retrieval system