KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725034Help
Entry
103725034         CDS       T03372                                 

Gene name
Dpp3
Definition
(RefSeq) dipeptidyl peptidase 3
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ngi01002]
    103725034 (Dpp3)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     103725034 (Dpp3)
Peptidases [BR:ngi01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   103725034 (Dpp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 103725034
NCBI-ProteinID: XP_008820495
Position
Un
AA seq 756 aa AA seqDB search
MGEPEAGSEFANGAAAAGPMADTQYILPNDIGVSSLDCREAFRLLSPTERLYAHHLSRAA
WYGGLAVLLQTSPEAPYIYSLLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYS
NMGNYKSFGDTKFVPNLPKEKLERVILGSKAAQQQPEEVRELWQTCGELMFSLEPRLRHL
GLGKEGVTTYFSGDCTMEDAKLAQDFMDSQNLSAYNTRLFKVVDQEGKPHYEVRLASVLN
TDPALDSEVTYKLKNYEFQGSHFQVTRGDYAPILQKVVEHLEKAKAYAANSHQEQMLAQY
MESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAMVNKAMSA
KFERLVASAEQLLKELPWPPAFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQT
EGFKNVSLGNVLAVAYATKREKLTFLEEEDKDLYIRWKGPSFDVQVGLHELLGHGSGKLF
VQDEKGAFNFDQETVINPETGEQIKSWYRSGETWDSKFSTIASSYEECRAETVGLYLCLN
PQVLEIFGFEGADAEDVIYVNWLNMVRAGLLALEFYTPEAASWRQAHMQARFVILRVLLE
AGEGLVTVTPTTGSDGRPDARVHLDRNKIRSVGRPALERFLRRLQVLKSTGDVVAGRALY
EGYAAVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSEVQLVEYEASAAGLIRSFC
ECFPEDGPELEEVVTQLATADARFWRGSMEAPAGQA
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgggggagccggaagcaggaagtgagttcgcgaacggagcagctgcagcagggcccatg
gcagatacccagtacatcctgcccaatgacattggtgtgtctagcctcgactgccgtgag
gccttccgcctgctgtcacccacagaacgtctctatgctcaccatctgtcacgggccgcc
tggtatggaggcctggccgtgctgcttcagacctcccctgaggccccctacatctattct
ctgctcagccgcctcttccgtgcccaagaccctgaccaactgcgccaacatgccctggct
gagggccttacagaagaggagtatcaggcattcctggtctatgccgcaggggtctactcc
aacatgggcaactataaatcctttggagacaccaagtttgttcccaacttgcccaaggag
aagctggaacgtgtgatcctggggagtaaggctgcccagcagcagccagaggaagtcagg
gaactctggcagacctgtggggagcttatgttctctctggagccaagacttcgacacctt
gggctggggaaggagggagttaccacctatttttctggggattgtaccatggaagatgct
aagctggcccaggactttatggactctcagaacctcagtgcgtacaacacacggctcttc
aaggtggtcgaccaggaagggaagccccactacgaggtgcgactggcttccgtgctcaac
acagatcctgctctggactctgaagtgacttacaagctgaagaactatgagttccagggg
agccatttccaggtcacccggggggactatgcccccatcctccagaaggtggtggagcac
ttggagaaagccaaggcgtatgcagccaacagtcaccaggagcagatgctagcccagtac
atggagagcttcacccagggctccattgaggcccacaagaggggctctcgcttctggatc
caggacaaaggccccatcgtggaaagttacatcggcttcattgagagctaccgtgacccc
tttggttcccgaggagagttcgaaggctttgtggccatggtgaacaaagccatgagtgcc
aagttcgagcgcctggtggcaagtgctgagcagctgctgaaagagctgccctggcctccc
gccttcgagaaggacaaattcctcacccctgacttcacttccttggatgtcctcaccttt
gctggctctggcatccctgcgggcatcaacatccctaactatgatgacctgaggcagaca
gaaggctttaagaacgtgtctctgggcaatgtgctggctgtggcctatgccacaaaacgg
gagaaactcacgttcctggaggaggaagacaaggacctgtacatccgctggaaggggccg
tcctttgatgtacaggtggggttgcatgagctgctgggccatggcagtggcaagctcttt
gtgcaggatgagaaaggtgcgtttaactttgaccaggagacagtgatcaacccagagact
ggagaacagattaagagctggtaccggagtggagagacatgggacagcaagttcagcacc
attgcctccagctatgaagagtgtcgggctgagaccgtgggcctttacctctgcctcaac
cctcaagtgctggagatctttggctttgagggggccgatgcagaagatgtaatctacgtg
aactggctcaacatggttcgggctggactgctggctttagagttctacaccccagaggca
gccagctggcgacaggcccacatgcaggctcggtttgtgatcctgagggttttgctggag
gctggcgaaggactcgttaccgtcactcccaccacaggctccgatgggcgcccagatgcc
cgggtccacctggaccgcaataagattcggtcagtgggcagacctgccctggagcggttc
ctaaggagactccaggtgctgaagtccacaggggatgtggttgcagggcgggccctgtat
gaggggtatgcagctgttactgatgcacccccggagtgcttcctcaccctcagggacacc
gtactgctgcgcaaggagtcccggaagctgatcgttcagcccaacactcgtcttgaaggc
tcagaagtacaacttgtggaatatgaggcctcagctgctggtctcatccgatccttctgt
gaatgcttccctgaggatgggcctgagttggaggaggtcgttacccagctagccacagca
gatgcccgattctggagaggctccatggaggctccagctggccaggcttga

DBGET integrated database retrieval system