KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725050
Entry
103725050         CDS       T03372                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)-like
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103725050
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     103725050
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 103725050
NCBI-ProteinID: XP_017650846
Position
Un
AA seq 242 aa
MCSLPESQEPMQCVAVTGGTHGNEMSGVYLARHWLQVPGELRRPSFSAIPILANPAATAA
CRRYVDRDLNRTFTHTFLNSRITRDDPYELTRARELNQLLGPKGTGQAFDFILDLHNTTA
NTGICLISEASHSHFNLHLCRYLQLQNPELPCRILQYQPSGEETYSVESVSKDGIGTTFP
AFEMDIYRNLGSVDFPRAADGDLAGTVHPRLQVAVGGVPEHQSQDCQGSQARIEGLSIPW
GP
NT seq 729 nt   +upstreamnt  +downstreamnt
atgtgttccctgcctgagtctcaggagcccatgcagtgtgtggctgtgactgggggcacc
cacggcaacgagatgtccggcgtctacctggcccggcactggctgcaggtccccggggag
ctgcggaggcccagcttctctgccataccaattctagccaaccctgcagccacagccgcc
tgccgtcgatacgtggaccgtgatctcaaccgcaccttcacccacaccttcctcaattcc
aggatcacccgggacgacccctacgagttgacaagagcccgagagctgaaccagctactg
ggtcccaagggcacaggacaggctttcgactttatcctggacttgcacaacaccacagcc
aacacgggcatctgcctcatctctgaagcctcccacagccactttaatctgcatttgtgc
cgctacctacagctgcagaacccagagctgccctgccgcatcttgcagtaccagccctct
ggggaggagacctacagtgtggaatcggtgtccaaggatggaatcggcacgacctttccc
gcctttgagatggacatctacaggaacctgggcagtgttgactttccacgcgccgcggac
ggcgacctggcgggcactgtgcatcccaggctgcaggtcgctgttgggggggttcctgaa
catcagtcccaggactgtcagggaagccaggccaggatagaggggctcagcatcccatgg
ggtccctaa

DBGET integrated database retrieval system