KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725101Help
Entry
103725101         CDS       T03372                                 

Gene name
Parp1
Definition
(RefSeq) poly(ADP-ribose) polymerase 1
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi03410  Base excision repair
ngi04210  Apoptosis
ngi04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    103725101 (Parp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103725101 (Parp1)
   04217 Necroptosis
    103725101 (Parp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ngi03032]
    103725101 (Parp1)
   03036 Chromosome and associated proteins [BR:ngi03036]
    103725101 (Parp1)
   03400 DNA repair and recombination proteins [BR:ngi03400]
    103725101 (Parp1)
Enzymes [BR:ngi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     103725101 (Parp1)
DNA replication proteins [BR:ngi03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     103725101 (Parp1)
Chromosome and associated proteins [BR:ngi03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    103725101 (Parp1)
DNA repair and recombination proteins [BR:ngi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     103725101 (Parp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT
Motif
Other DBs
NCBI-GeneID: 103725101
NCBI-ProteinID: XP_008820594
Position
Un
AA seq 1013 aa AA seqDB search
MAEASDKLYRVEYAKSGRASCKKCSDSIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRQPDIEVDGFSELRWDDQQKVKKTAEAGGVAGKGQDGIGGKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPNCFVKNREELGFRPEYNASQ
FKGFSLLSDEDKETLKKQLPGIKSEGKRKGDEVDGTDEVAKKKSKKEKDKDSKLEKALKA
QNELIWNIKDELRKVCSTNDLKELLIFNQQQVPSGESAILDRVADGMAFGALLPCEKCSG
QLVFKGDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
TSAPAPVAPPLSAASAPTVMNSSAPADKPLSNMKILTLGKLSQSKDEVKATVEKLGGKLT
GSANKASLCISTKKEVEKMNKKMEEVKAANVRVVCEDFLQDVPASTKSLQELLSAHNLSS
WGAEVKVETVEVKAPKGKSSAPSKKSKGPAKEEGVNKSEKRMKLTLKGGAAVDPDSGLEH
SAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKESRYWIFRSWGRVGTVIGSNKL
EQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVKPGS
KSKLPKPIQELVGMIFDVESMKKALVEYEIDLQKMPLGKLSRRQIQAAYSILSEVQQAVS
QGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNAESVQAKVEMLDNLLDIEVAYSLLRGG
SDDTSKDPIDVNYEKLKTDIKVVDKDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIER
EGESQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMV
SKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSAS
ITLEGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcctcggacaagctctaccgagtggagtacgccaagagcgggcgagcctct
tgcaagaaatgcagcgacagcatccccaaggactcgctccgcatggccatcatggtgcag
tcacccatgtttgacgggaaggtaccacactggtaccacttctcctgcttctggaaggtg
ggccactccatccggcagcctgacattgaagtagatgggttctctgagctgcggtgggac
gaccagcagaaggtcaagaagactgcggaggctggaggagtggcaggcaaaggccaggat
ggaattggaggcaaggcagaaaagacactgggcgactttgcagcagagtatgccaaatcc
aacagaagcacatgcaagggctgtatggagaagatagaaaagggccaggtgcgcctgtcc
aagaagatgctggacccagagaagccacaactgggcatgattgaccgctggtaccatcca
aactgctttgtcaagaaccgggaggagctaggcttccggcctgagtataatgccagccag
tttaagggcttcagcctcctctctgatgaagacaaagaaactctgaagaagcagctccca
ggcatcaagagcgaaggaaagaggaaaggtgacgaggtagatggaacagatgaggtggcc
aagaagaagtctaaaaaagaaaaagacaaggacagcaagctggaaaaggccctcaaggcc
cagaatgagctgatttggaacatcaaggatgagctgaggaaggtgtgctccaccaacgac
ctgaaagagctgcttatcttcaaccagcaacaagtgccatctggggagtcagcgatcttg
gaccgtgttgctgatggcatggcatttggggccctcctgccctgtgagaagtgctcgggc
cagctggtcttcaagggtgatgcttattactgtactggggatgtcactgcatggactaag
tgcatggtcaagacacagactcccaaccggaaggaatgggtgaccccaaaggaattccga
gaaatctcttacctcaagaaattaaaggtcaaaaagcaggatcggatattccccccagaa
accagtgccccagcgcctgtggcccccccactctctgcagcctcagcacccacagttatg
aactcctctgccccagcagataagccactgtccaacatgaagatcctgacacttggtaaa
ctctcccagagcaaagatgaagtgaaggccacggttgaaaagctcgggggcaagttgaca
ggatcggccaacaaagcttccctgtgcatcagcactaaaaaggaggtagaaaagatgaat
aagaagatggaggaagtaaaagcagccaatgttcgtgtcgtgtgtgaggacttcctccag
gatgtacctgcctccactaagagcctccaggaattgctctcagcccacaatttgtcctcc
tggggggccgaagtgaaggtagaaactgttgaagtaaaggcccccaaagggaagtcatcc
gcaccctccaagaagagcaagggccctgccaaggaggaaggtgtcaacaagtctgaaaag
aggatgaaattaactctcaagggaggagcagctgttgaccctgactctggtctggaacac
tctgcacacgtcctggagaaaggtgggaaggtgtttagtgccacacttggcctggtggac
attgtcaaagggaccaactcctattacaaactgcagcttctggaagatgacaaggagagc
aggtactggatcttccggtcctggggccgcgtgggcacagtgattggcagtaacaaactg
gagcagatgccatccaaggaggatgccattgagcacttcatgaagttatatgaagagaaa
actggaaatgcctggcactctaaaaacttcacaaagtatcccaaaaagttctaccctctg
gagattgactatggccaggatgaagaggcagtgaagaagctgacagtaaagcctggctcc
aagtccaagctcccaaagccaattcaggagcttgttgggatgatcttcgacgtggagagc
atgaaaaaagccctggtggagtatgagattgacctccaaaagatgcccttggggaagctg
agcagaaggcagatccaggccgcctactccatactcagcgaggtccagcaggcagtgtcc
cagggcagcagtgactcccagatcctggatctctccaatcgtttctataccctgatcccc
catgactttggaatgaagaagcccccactcctgaataatgcagaaagtgtacaggccaag
gtggagatgctagacaacctcctggacatcgaggtggcctacagtcttctcaggggtggg
tctgatgacaccagtaaggaccccattgatgtcaactacgagaagctcaaaactgacatt
aaggtggttgacaaagactctgaagaagctgaggtcatcaggaagtatgttaagaacact
cacgccaccactcacaatgcctatgacctggaggtgatagatatctttaagatagagcgt
gagggagaaagccagcgctacaaacccttcaagcagcttcacaacaggaggttgctatgg
cacgggtccaggaccaccaactttgccggcatcttatctcagggtctgcggatagcccca
cctgaagcacctgtgacaggctacatgtttgggaaagggatctattttgccgacatggta
tccaagagtgccaactactgccacacatctcagggagaccccattggcctaatactattg
ggagaagttgctcttggaaacatgtatgaacttaagcatgcttcgcatatcagcaagtta
cccaagggcaaacacagtgtcaaaggtttgggcaaaaccactcctgacccttcggccagc
atcacactggagggtgtagaggttccactggggactgggatcccatcaggtgttaatgac
acctgcctgctgtataacgagtacattgtctatgacattgctcaggtgaatctgaagtat
ctgctgaaactgaaattcaattttaagacatccctgtggtaa

DBGET integrated database retrieval system