KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103725294Help
Entry
103725294         CDS       T03372                                 

Definition
(RefSeq) dedicator of cytokinesis protein 8-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ngi04131]
    103725294
Membrane trafficking [BR:ngi04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    103725294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3398 DOCK-C2 DOCK_N Cathelicidins DUF2080
Motif
Other DBs
NCBI-GeneID: 103725294
NCBI-ProteinID: XP_017650967
Position
Un
AA seq 599 aa AA seqDB search
MATLPSAERRAFALKINRYSSAEIRKQFTLPPNLGQYHRQSISTSGFPSLQLPQLYDPVE
PVDFEGLLMTHLSSLDLELVQELGDLKDDDLDVAFTPKECRTLQPSLPEEGVELDPHVRD
CVQTYIREWLIVNRKNQGAPEFCSFKKTGSRKDFHKTLQKQTFESETLECGEPATQTGPR
RLNVLCDVSGKGPLTACDFDLRSLQPDQRLENLLQLVSTEDFEKEKEEARRTNRQAELFA
LYPSVDEEDAVEIRPVPECPKEHLGNRILVKVLTLKFEIEIEPLFASIALYDVKERKKIS
ENFHCDLNSDQFKGFLRAHTPSVDPSSQARSAVFSVTYPSSDIYLVVKIEKVLQQGEITD
CAEPYMVIKESDGGKSKEKVEKLKLQAESFCQRLGKYRMPFAWAPISLASFFNVSTLERE
GVDMEPMLGRNSVSERRTLSQSRRLSERTLSLEENGVGSSFKPTTLATNVFFKQEGDRLS
DEDLFKFLADYKRSSSLQRRVKSIPGSLRLEISPAPEVINCCLTPEMLPVRPFPENRTRP
HKEILEFPIREVYVPHTVYRNLLYVYPQRLNFANKLASARNITIKIQFMCGEDPSNAMP
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggccacgctgcccagcgccgagcgccgcgccttcgcgctcaagatcaacaggtattca
tcagcagaaataagaaagcagtttacactcccacccaaccttgggcagtaccatcggcag
agcatcagtacatctggcttcccctcccttcagctacctcagctttatgaccccgtggag
ccggtggacttcgaaggacttctgatgacacacttaagcagcttggatctggagctggtc
caggagctgggagacctcaaggatgacgacttggatgtggcgttcacacccaaggaatgt
aggactttgcagccctctctgccagaggaaggagtcgaactagaccctcatgtcagggac
tgtgttcagacctatattcgagagtggctgattgtgaaccgcaaaaaccaaggagctcca
gagttttgcagttttaaaaagactggatctcggaaagattttcacaagactcttcagaaa
cagacgttcgagtcagaaaccttggagtgcggtgaacccgccactcagacaggccctcgt
cgcttaaacgtgctgtgtgatgtgtctgggaagggtccacttactgcctgtgactttgac
ctccgaagcctgcagcctgatcagcggctggaaaacctgctgcagcttgtgagtacagag
gacttcgagaaggagaaggaggaggcccgcaggaccaatcggcaagccgagctctttgcc
ctgtatccatctgtggacgaggaggatgctgtggaaatacgtccggtaccagaatgtcct
aaggaacatctgggcaacagaatattggtcaaggtactgactctgaaatttgagatcgaa
attgagcctctgtttgccagcattgccctctatgatgttaaagaaaggaaaaagatctca
gaaaattttcactgtgacctgaactctgaccagttcaaaggatttctgcgagctcacaca
ccctcagttgacccatcgagtcaggcaagatctgcggtgttctcggtcacctacccatcc
tcagacatctatctggtagtcaagattgaaaaagtcctccagcagggagaaattacagac
tgtgcagaaccatacatggtcatcaaggaaagtgatggtggaaagagtaaagaaaaggtt
gagaaactaaaacttcaagctgaatccttctgccaacgtttggggaaataccggatgccc
tttgcctgggcccccattagcttagcaagcttcttcaatgtctccacccttgagagggag
ggagttgatatggagcctatgcttgggagaaactctgtgagtgagcggaggactttgtcc
caatctaggcggctttctgagcgaaccctctccttagaggaaaatggagttggatccagc
ttcaagcccaccaccctggccactaacgtcttcttcaagcaggagggagatcgccttagt
gatgaagacttattcaagtttttagccgactacaagaggtcatcatccttacagagaagg
gtcaaatccatcccaggttccctcagactggagatctccccagctcccgaggtgatcaac
tgctgcctgacgcctgagatgctgcctgtgagacccttccctgaaaaccggacacgccca
cacaaggagattttggaatttccaattcgggaagtgtatgtccctcacaccgtgtacaga
aatcttctgtatgtctacccacagagactgaactttgctaacaaactagcatctgcccgg
aacattacaataaaaatccagtttatgtgtggagaagatcctagcaacgctatgccg

DBGET integrated database retrieval system