KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103727194Help
Entry
103727194         CDS       T03372                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00230  Purine metabolism
ngi01100  Metabolic pathways
ngi04022  cGMP-PKG signaling pathway
ngi04270  Vascular smooth muscle contraction
ngi04540  Gap junction
ngi04611  Platelet activation
ngi04713  Circadian entrainment
ngi04730  Long-term depression
ngi04921  Oxytocin signaling pathway
ngi04924  Renin secretion
ngi04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103727194
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    103727194
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103727194
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103727194
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103727194
   04924 Renin secretion
    103727194
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103727194
  09154 Digestive system
   04970 Salivary secretion
    103727194
  09156 Nervous system
   04730 Long-term depression
    103727194
  09159 Environmental adaptation
   04713 Circadian entrainment
    103727194
Enzymes [BR:ngi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     103727194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 103727194
NCBI-ProteinID: XP_008823230
Position
Un
AA seq 772 aa AA seqDB search
MTYTVYDDIITIKLIQEACKVLDVSMEAILKLFGEYFFNFCKRSGYDRMLRTLGGNLTEF
IENLDALHSYLALSYQEMNAPSFRVERGANREMLLHYYSDRRGLCHIVPGIIEAVAKDFF
DIDVVMNILDMNEEVEKMGKKEHVVFLVVQKACRQTKSTRSNRLQDHQDTQRDQEALQAT
FPRMKEKYLSTSICPGEKSHWEVVRGILPFGKGYLRDTFQPIYPERLWIEEKTFCNAFPF
HIVFDETLTVKQAGVNIQKFIPGLQAQKIRLDDYFSIVHPQVTFSISSICKFINSQFVLK
ARREMMPKAWKSQLALKLRGQMIWMESLQCMIFICSPKLRSLQELEENKMYLSDIAPHDT
TRDLILLNQQRLAEMELSNQLERKKEELRILSQHLAIEKKKTETLLYAMLPEHVANQLKD
GQKVAAGEFESCTILFSDVVTFTNICAACEPIQIVTMLNSMYSKFDRLTNIHEVYKVETI
GDAYMVVGGVPVPVENHAQRVANFALGMRISAEDVMNPVTGEPIQIRVGIHTGPVLAGVV
GDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTTYRALENQGFEIVERGEIEVKGKGKM
TTYFLIQNLNATEDEIMGRAKTLADHKEARAPENQDRKSFSVLRYRDGQQLLHKGHVTDG
ELASDTPTSDEATPPGSPVAGQDSMEAAAGGSTSYVVEREREQQFSRDLNCTSNAIDIYP
GNCDKIYDNIIVAPGKCTRPQACSPMSVIHQTFLMQKMIINTEKHKWPKYRE
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgacctatactgtgtatgatgacatcatcaccattaagctcatccaagaagcctgcaag
gttttggatgtatctatggaagccattctgaaactctttggagagtacttcttcaacttc
tgtaagaggtccggctatgataggatgctgcggacactgggaggaaacctcacagagttt
attgaaaacctagatgccctccacagttatctggctctgtcttaccaggagatgaatgca
ccatcctttcgtgtggagagaggagccaacagggagatgcttctgcattactactctgat
agaagaggtctgtgccacatcgtaccaggtatcattgaggctgtggccaaggacttcttt
gacattgatgtggtcatgaatatccttgacatgaatgaagaagtggagaagatggggaaa
aaggaacacgttgtgtttttggttgtgcagaaagcttgcaggcagacaaagagtacaagg
tcaaacaggttacaagaccatcaggacacccagagagaccaagaggctctccaggcaact
tttccaaggatgaaggagaaatatttgagcacctctatttgccctggggagaaatcccac
tgggaggttgtgagggggatactcccctttggaaaagggtacctcagggacactttccag
cccatctatcctgagagactgtggatcgaagagaagacattctgcaatgctttccccttc
cacattgtctttgatgaaacactgacggtcaagcaagctggagtgaatattcagaaattc
atcccaggactccaagcccagaagattcgattagatgactatttctccatcgttcaccct
caagtcaccttcagcatttctagcatctgcaagtttatcaacagtcaatttgtcctgaag
gcacggagggaaatgatgcccaaggcatggaagagccagctggcactcaaactcaggggc
cagatgatatggatggagtcactgcagtgcatgatcttcatatgttctccgaagctccgc
agcctgcaagaactggaggaaaacaagatgtatctttcagacattgccccccatgacacc
accagggatcttatcctcctcaaccagcagcggctagcagagatggagctgtccaaccag
ctagagaggaagaaggaggagctgcgcatcctctcccagcacctggctatcgaaaagaag
aagacagagaccttgctgtatgccatgctacctgaacacgtggccaaccagctcaaggat
ggccagaaggtggctgcaggagaatttgagtcctgtacaatccttttcagtgatgtggtg
acatttaccaacatctgtgctgcctgtgaacctatccaaatagtgactatgctgaactca
atgtactccaagtttgacagattaaccaacatccacgaggtctacaaagtagaaacaata
ggtgatgcatacatggtggtaggcggtgtgccagtgcctgttgaaaaccatgctcagaga
gtagctaattttgccttggggatgagaatttctgcagaagatgtgatgaatcctgtcact
ggagaacccatccagatcagagtggggatccatactggaccagtcttagcaggtgtcgtg
ggagacaagatgccccgatactgcttgtttggtgatactgtaaacacagcctctaggatg
gaaagtcatgggcttcccaacaaagtacatctcagccccacaacctacagagccttggaa
aatcaagggtttgaaattgttgaaagaggtgaaattgaggtgaagggtaaaggaaaaatg
accacatactttctgatccagaacttgaatgccacagaggatgaaatcatggggagagct
aaaacgctagcagatcacaaggaagcaagggctcctgaaaaccaagataggaagtccttt
tctgtcctgaggtacagggacggtcagcagctgctccacaaagggcatgtaacagatggg
gagctagcttcagatactcccacttctgatgaagccacacctcctgggagccctgtggca
ggacaagactccatggaggcagctgctgggggctccacttcatatgtggtggagagggaa
agagaacaacagttctctagagacctcaattgtacatctaatgccattgacatctaccct
ggaaactgtgataaaatatacgacaacatcattgtggcaccaggcaagtgcactcgaccc
caagcctgcagtcccatgagtgtgatacaccaaaccttcctcatgcaaaagatgatcatt
aacacagaaaagcacaagtggccaaagtacagagaataa

DBGET integrated database retrieval system