KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103728747
Entry
103728747         CDS       T03372                                 

Gene name
Apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04080  Neuroactive ligand-receptor interaction
ngi04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103728747 (Apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103728747 (Apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 103728747
NCBI-ProteinID: XP_008824930
Position
Un
AA seq 78 aa
MNLWLCVQALLLLLWLSLTAVCGVPLMQPPDGKGLMEGNVRYLVKPRVSRTGPGPWQGGR
RKFRRQRPRLSHKGPMPF
NT seq 237 nt   +upstreamnt  +downstreamnt
atgaatctgtggctctgcgtgcaggcgctgctgctgctgctctggctctccttgaccgca
gtgtgtggagtgccactgatgcagcctccagatgggaaagggctgatggaaggcaacgtg
cgttacctggtgaagcccagagtttctaggactggaccagggccctggcagggaggccgg
aggaaattccgccgccagcgtccccgcctctcccataagggccccatgcctttctga

DBGET integrated database retrieval system