KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103728817Help
Entry
103728817         CDS       T03372                                 

Gene name
Tgfb2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi04010  MAPK signaling pathway
ngi04060  Cytokine-cytokine receptor interaction
ngi04068  FoxO signaling pathway
ngi04110  Cell cycle
ngi04218  Cellular senescence
ngi04350  TGF-beta signaling pathway
ngi04380  Osteoclast differentiation
ngi04390  Hippo signaling pathway
ngi04933  AGE-RAGE signaling pathway in diabetic complications
ngi05140  Leishmaniasis
ngi05142  Chagas disease (American trypanosomiasis)
ngi05144  Malaria
ngi05145  Toxoplasmosis
ngi05146  Amoebiasis
ngi05152  Tuberculosis
ngi05161  Hepatitis B
ngi05166  Human T-cell leukemia virus 1 infection
ngi05200  Pathways in cancer
ngi05205  Proteoglycans in cancer
ngi05206  MicroRNAs in cancer
ngi05210  Colorectal cancer
ngi05211  Renal cell carcinoma
ngi05212  Pancreatic cancer
ngi05220  Chronic myeloid leukemia
ngi05225  Hepatocellular carcinoma
ngi05226  Gastric cancer
ngi05321  Inflammatory bowel disease (IBD)
ngi05323  Rheumatoid arthritis
ngi05410  Hypertrophic cardiomyopathy (HCM)
ngi05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103728817 (Tgfb2)
   04350 TGF-beta signaling pathway
    103728817 (Tgfb2)
   04390 Hippo signaling pathway
    103728817 (Tgfb2)
   04068 FoxO signaling pathway
    103728817 (Tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103728817 (Tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103728817 (Tgfb2)
   04218 Cellular senescence
    103728817 (Tgfb2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103728817 (Tgfb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103728817 (Tgfb2)
   05206 MicroRNAs in cancer
    103728817 (Tgfb2)
   05205 Proteoglycans in cancer
    103728817 (Tgfb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103728817 (Tgfb2)
   05212 Pancreatic cancer
    103728817 (Tgfb2)
   05225 Hepatocellular carcinoma
    103728817 (Tgfb2)
   05226 Gastric cancer
    103728817 (Tgfb2)
   05220 Chronic myeloid leukemia
    103728817 (Tgfb2)
   05211 Renal cell carcinoma
    103728817 (Tgfb2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103728817 (Tgfb2)
   05321 Inflammatory bowel disease (IBD)
    103728817 (Tgfb2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    103728817 (Tgfb2)
   05414 Dilated cardiomyopathy (DCM)
    103728817 (Tgfb2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103728817 (Tgfb2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103728817 (Tgfb2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103728817 (Tgfb2)
   05161 Hepatitis B
    103728817 (Tgfb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103728817 (Tgfb2)
   05144 Malaria
    103728817 (Tgfb2)
   05145 Toxoplasmosis
    103728817 (Tgfb2)
   05140 Leishmaniasis
    103728817 (Tgfb2)
   05142 Chagas disease (American trypanosomiasis)
    103728817 (Tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ngi04052]
    103728817 (Tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:ngi00536]
    103728817 (Tgfb2)
Cytokines and growth factors [BR:ngi04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103728817 (Tgfb2)
Glycosaminoglycan binding proteins [BR:ngi00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   103728817 (Tgfb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide Disaggr_repeat
Motif
Other DBs
NCBI-GeneID: 103728817
NCBI-ProteinID: XP_008825028
Position
Un
AA seq 307 aa AA seqDB search
MPQHFPSENAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVAEQRIE
LYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVQEWLHHKDRNLGFKISLHCP
CCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLP
SYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCA
GACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYVGKTPKIEQLSNMI
VKSCKCS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagcatttcccctccgaaaatgccatcccgcctactttctacagaccctacttc
agaattgtccgctttgatgtctcagcaatggagaagaacgcttccaacctggtgaaggcg
gagttcagagtcttccgtttgcagaaccccaaagccagagttgctgaacagcgcatcgaa
ctgtatcagatcctcaaatccaaagatctaacatctccaactcagcgctacattgatagt
aaggtggtcaaaacgagagccgagggcgagtggctgtccttcgacgtgactgacgcggta
caggaatggctgcaccacaaagacaggaacctgggatttaagatcagtttgcactgcccc
tgctgcacctttgtaccatctaacaactacatcatcccgaataagagcgaggagcttgaa
gccagatttgcaggtattgatggcacctccacatataccagtggtgatcagaaaactata
aagtccactaggaaaaaaaacagtgggaagaccccacatctcctgctaatgttgttgccc
tcctacagactggaatcacaacagtccaaccggcggaagaagcgcgctttggatgcagcc
tattgctttagaaatgtgcaggataattgctgcctacgtcccctttacattgatttcaag
agggatcttgggtggaaatggatccatgaacccaaagggtacaatgccaacttctgtgct
ggggcatgcccgtatctgtggagttcagacactcaacacagtagggttctcagcttgtat
aataccataaatccagaagcttccgcatctccttgctgtgtgtcccaggatctggaacca
ctgaccattctctactacgttggcaaaactcccaagatcgaacagctgtccaacatgatt
gtcaagtcttgcaaatgcagctaa

DBGET integrated database retrieval system