KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730350Help
Entry
103730350         CDS       T03372                                 

Gene name
Mgll
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00561  Glycerolipid metabolism
ngi01100  Metabolic pathways
ngi04714  Thermogenesis
ngi04723  Retrograde endocannabinoid signaling
ngi04923  Regulation of lipolysis in adipocytes
Module
ngi_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    103730350 (Mgll)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    103730350 (Mgll)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    103730350 (Mgll)
  09159 Environmental adaptation
   04714 Thermogenesis
    103730350 (Mgll)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ngi01002]
    103730350 (Mgll)
Enzymes [BR:ngi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103730350 (Mgll)
Peptidases [BR:ngi01002]
 Serine Peptidases
  Family S33
   103730350 (Mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Peptidase_S9 Abhydrolase_5 Abhydrolase_3 LIDHydrolase PGAP1 Thioesterase Ser_hydrolase DUF1350 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 103730350
NCBI-ProteinID: XP_008826783
Position
Un
AA seq 313 aa AA seqDB search
METGLEDLPRMPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHG
AGEHCGRYDELAQMLRGLNLLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTVQKD
HPGLPVFLLGHSMGGAISILAAAERPAHFAGMVLISPLVVANPESATTFKVLAAKVLNLV
LPNMSLGPIDSSVLSRNKSEVDLYDSDPLICRAGVKVCFGIQLLNAVSRVERAMPRLTLP
FLLLQGSADRLCDSKGAYLLMDSSQSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWV
SHRTAAAGVGCPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggacttgaagaccttcccaggatgcctgaggcaagttctcctaggcggacc
ccacagaatgtcccataccaggacctgcctcacctggtcaatgcagatggacagtacctc
ttttgtaggtactggaagcccagtggcacacccaaggccctcatctttgtgtcccatggt
gctggggagcactgtggccgttatgacgagctggctcagatgctgagggggctgaacctg
ctggtgttcgcccacgaccacgttggccatgggcagagcgagggggagaggatggtggtg
tccgatttccaagttttcgtcagggatgtgctgcagcacgtggacactgtacagaaggac
caccccgggctccctgtcttcctcttgggccactccatgggtggtgccatctccatcctg
gcagctgcagagaggccagcccacttcgctggcatggtcctgatttcgcctctggttgtt
gctaatccagaatctgcaacaactttcaaggtccttgctgctaaagtgctcaatcttgtc
ctgccaaacatgtccctggggcccatcgactccagcgtgctctctcggaataaatcagag
gtcgacctttatgactcggaccccctcatctgccgcgcaggagtgaaggtttgctttggc
atccagctgctgaacgcagtctcccgggtagagcgcgcgatgcccaggctgacgctgccc
ttcctgctgctgcagggctcggctgaccggctgtgtgacagcaaaggggcctacctgctc
atggactcctcccagagccaggacaagacgctcaagatatatgaaggtgcctaccatgtt
ctccacaaagagctcccagaagtgaccaactctgtcttccatgaaataaacatgtgggtc
tctcacaggacagcagcagcaggagtcgggtgcccaccctga

DBGET integrated database retrieval system