KEGG   Nannospalax galili (Upper Galilee mountains blind mole rat): 103730983
Entry
103730983         CDS       T03372                                 

Gene name
Dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ngi  Nannospalax galili (Upper Galilee mountains blind mole rat)
Pathway
ngi00230  Purine metabolism
ngi00240  Pyrimidine metabolism
ngi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ngi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103730983 (Dck)
   00240 Pyrimidine metabolism
    103730983 (Dck)
Enzymes [BR:ngi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     103730983 (Dck)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 Phage_lysozyme
Other DBs
NCBI-GeneID: 103730983
NCBI-ProteinID: XP_008827517
Position
Un
AA seq 260 aa
MATPPKRVCFSPAAGSEGTRVKKISIEGNIAAGKSTFVNILKQVCEDWEMVPEPVARWCN
VQNAQDEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLASLNGKLKDAE
KPVVFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNSQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPVLTLDVNE
DFKDKHESLVEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagagagtctgcttctctccagccgccggctccgagggcacccgc
gtcaagaaaatctccatcgagggcaacatcgctgcaggaaagtcaacatttgtcaatatc
cttaaacaagtttgtgaggattgggaaatggttcctgaacctgttgccagatggtgcaat
gttcaaaatgctcaagatgaatttgaggaactgacaacatctcagaaaagtggtgggaat
gttcttcagatgatgtatgagaagcctgagcgatggtcattcaccttccaatcatatgcc
tgtctcagtcggatccgagctcagcttgcctccctcaatggcaagctcaaagatgcagag
aaacctgtggtgttttttgaacggtctgtttatagtgacaggtatatttttgcatctaat
ttgtatgaatctgactgcatgaatgaaacagagtggacaatatatcaagactggcatgac
tggatgaatagccaatttggccaaagccttgaattggatggaatcatttatcttcgagct
actccagagaaatgtttaaatagaatatatttacgaggaagaaatgaagagcagggcatt
cctcttgaatatttagagaaacttcattataaacatgaaagctggctcctgcatagaacc
ctgaaaaccaactttgattatctacaagaggtgcctgtcctcacactggatgttaatgaa
gacttcaaagacaaacatgagagtctggttgaaaaggtcaaagaatttttgagtactttg
tga

DBGET integrated database retrieval system